BLASTX nr result
ID: Angelica22_contig00001054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00001054 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotian... 80 2e-13 sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding ... 79 4e-13 sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding ... 79 5e-13 emb|CBI15540.3| unnamed protein product [Vitis vinifera] 78 9e-13 ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycin... 78 9e-13 >gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana] Length = 326 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 395 AGKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 282 +GKNKVIYCTSL WSADGSTLFSGYTDG++RVWGIGRY Sbjct: 289 SGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRY 326 >sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|402538|dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum] Length = 326 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 395 AGKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 282 +GKNKVIYCTSLSWSADGSTLFSGYTDG++RVWGI RY Sbjct: 289 SGKNKVIYCTSLSWSADGSTLFSGYTDGLIRVWGIDRY 326 >sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|1695181|emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia] Length = 326 Score = 78.6 bits (192), Expect = 5e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 395 AGKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 282 +GKNKVIYCTSL WSADGSTLFSGYTDG++RVWGIGR+ Sbjct: 289 SGKNKVIYCTSLGWSADGSTLFSGYTDGLIRVWGIGRF 326 >emb|CBI15540.3| unnamed protein product [Vitis vinifera] Length = 1318 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 389 KNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 282 K K+IYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY Sbjct: 1283 KGKIIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 1318 >ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max] gi|255645048|gb|ACU23023.1| unknown [Glycine max] Length = 325 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -3 Query: 398 NAGKNKVIYCTSLSWSADGSTLFSGYTDGVVRVWGIGRY 282 N K KVIYCTSL+WS+DGSTLFSGYTDGVVRVWGIGRY Sbjct: 287 NPNKKKVIYCTSLNWSSDGSTLFSGYTDGVVRVWGIGRY 325