BLASTX nr result
ID: Angelica22_contig00000299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00000299 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533051.1| conserved hypothetical protein [Ricinus comm... 84 1e-14 ref|XP_004149323.1| PREDICTED: EPIDERMAL PATTERNING FACTOR-like ... 83 3e-14 ref|XP_002301818.1| predicted protein [Populus trichocarpa] gi|2... 82 3e-14 ref|XP_003622774.1| EPIDERMAL PATTERNING FACTOR-like protein [Me... 82 5e-14 ref|NP_193033.1| epidermal patterning factor-like protein 9 [Ara... 82 6e-14 >ref|XP_002533051.1| conserved hypothetical protein [Ricinus communis] gi|223527149|gb|EEF29321.1| conserved hypothetical protein [Ricinus communis] Length = 107 Score = 84.0 bits (206), Expect = 1e-14 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 1 YNECRGCKFRCRAEQVPVEGNDPMNSAYHYKCICHR 108 YNECRGCK++CRAEQVPVEGNDP+NSAYHYKC+CHR Sbjct: 72 YNECRGCKYKCRAEQVPVEGNDPINSAYHYKCVCHR 107 >ref|XP_004149323.1| PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 9-like [Cucumis sativus] Length = 113 Score = 82.8 bits (203), Expect = 3e-14 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 1 YNECRGCKFRCRAEQVPVEGNDPMNSAYHYKCICHR 108 YNECRGCK++CRAEQVPVEGNDP+NSAYHY+C+CHR Sbjct: 78 YNECRGCKYKCRAEQVPVEGNDPINSAYHYRCVCHR 113 >ref|XP_002301818.1| predicted protein [Populus trichocarpa] gi|222843544|gb|EEE81091.1| predicted protein [Populus trichocarpa] Length = 107 Score = 82.4 bits (202), Expect = 3e-14 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 1 YNECRGCKFRCRAEQVPVEGNDPMNSAYHYKCICHR 108 YNECRGCK++CRAEQVPVEGNDP++SAYHYKCICHR Sbjct: 72 YNECRGCKYKCRAEQVPVEGNDPIHSAYHYKCICHR 107 >ref|XP_003622774.1| EPIDERMAL PATTERNING FACTOR-like protein [Medicago truncatula] gi|355497789|gb|AES78992.1| EPIDERMAL PATTERNING FACTOR-like protein [Medicago truncatula] Length = 107 Score = 82.0 bits (201), Expect = 5e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 YNECRGCKFRCRAEQVPVEGNDPMNSAYHYKCICHR 108 YNECRGCK+RCRAEQVPVEGNDP+NS YHY+C+CHR Sbjct: 71 YNECRGCKYRCRAEQVPVEGNDPINSPYHYRCVCHR 106 >ref|NP_193033.1| epidermal patterning factor-like protein 9 [Arabidopsis thaliana] gi|75210732|sp|Q9SV72.1|EPFL9_ARATH RecName: Full=EPIDERMAL PATTERNING FACTOR-like protein 9; Short=EPF-like protein 9; Flags: Precursor gi|5123938|emb|CAB45496.1| putative protein [Arabidopsis thaliana] gi|7267999|emb|CAB78339.1| putative protein [Arabidopsis thaliana] gi|51969894|dbj|BAD43639.1| putative protein [Arabidopsis thaliana] gi|332657809|gb|AEE83209.1| epidermal patterning factor-like protein 9 [Arabidopsis thaliana] Length = 102 Score = 81.6 bits (200), Expect = 6e-14 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +1 Query: 1 YNECRGCKFRCRAEQVPVEGNDPMNSAYHYKCICHR 108 YNECRGC+++CRAEQVPVEGNDP+NSAYHY+C+CHR Sbjct: 67 YNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR 102