BLASTX nr result
ID: Anemarrhena21_contig00073253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00073253 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB88746.1| trypsin inhibitor [Allium cepa] 57 4e-06 >dbj|BAB88746.1| trypsin inhibitor [Allium cepa] Length = 101 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -1 Query: 289 RRPQEFARCSCQDLVDSCHPSCRRCVPL-LGSDPPKYSCEDMGYFACNRPC 140 RR + ARC C+D+V SC P C+RC L +PP+Y C+DM + +C C Sbjct: 48 RRAPDLARCECRDVVTSCGPGCKRCEEADLDLNPPRYVCKDMSFHSCQTRC 98