BLASTX nr result
ID: Anemarrhena21_contig00073046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00073046 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909910.1| PREDICTED: helicase SEN1-like [Elaeis guinee... 63 9e-08 >ref|XP_010909910.1| PREDICTED: helicase SEN1-like [Elaeis guineensis] Length = 914 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 5/61 (8%) Frame = -3 Query: 298 NGSTLTESESIWGRLVSDARDRGCFFNYDAVEGITSTIANACAESGILS-----SSPHIS 134 NG TLT SESIWGRLV DA+ RGCFFN D G+ I +AC E L+ S HIS Sbjct: 825 NGPTLTNSESIWGRLVHDAKKRGCFFNADDDRGLADAITDACIELDDLNDLLNMDSLHIS 884 Query: 133 K 131 + Sbjct: 885 R 885