BLASTX nr result
ID: Anemarrhena21_contig00072238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00072238 (393 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009393418.1| PREDICTED: DNA polymerase alpha catalytic su... 58 2e-06 >ref|XP_009393418.1| PREDICTED: DNA polymerase alpha catalytic subunit [Musa acuminata subsp. malaccensis] Length = 1541 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -2 Query: 341 QRISSMFTSSMFRKNERTLKAGSLASESIIDDVLAEFAP 225 QR+SSMFTSS+F+KN+RT K SL+S+SI+DDV+AEFAP Sbjct: 146 QRLSSMFTSSVFKKNDRT-KGSSLSSDSIVDDVIAEFAP 183