BLASTX nr result
ID: Anemarrhena21_contig00071535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071535 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera] 107 7e-27 emb|CAN60373.1| hypothetical protein VITISV_034932 [Vitis vinifera] 107 7e-27 emb|CAN62019.1| hypothetical protein VITISV_019561 [Vitis vinifera] 107 8e-27 emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera] 106 1e-26 emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera] 105 2e-26 emb|CAN73765.1| hypothetical protein VITISV_035279 [Vitis vinifera] 107 2e-26 emb|CAN65095.1| hypothetical protein VITISV_011639 [Vitis vinifera] 105 3e-26 emb|CAN71505.1| hypothetical protein VITISV_021018 [Vitis vinifera] 106 3e-26 emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera] 104 4e-26 emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera] 106 4e-26 emb|CAN67245.1| hypothetical protein VITISV_008680 [Vitis vinifera] 104 4e-26 emb|CAN66669.1| hypothetical protein VITISV_032496 [Vitis vinifera] 104 5e-26 emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera] 107 6e-26 emb|CAN82505.1| hypothetical protein VITISV_039312 [Vitis vinifera] 107 3e-25 emb|CAN76465.1| hypothetical protein VITISV_007267 [Vitis vinifera] 107 2e-23 emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] 95 3e-23 ref|XP_004513812.1| PREDICTED: uncharacterized protein LOC101489... 98 6e-23 emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] 93 3e-22 ref|XP_010113352.1| Retrovirus-related Pol polyprotein from tran... 96 2e-21 emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera] 90 3e-21 >emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera] Length = 1394 Score = 107 bits (266), Expect(2) = 7e-27 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 729 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 788 Query: 256 MDV 264 MDV Sbjct: 789 MDV 791 Score = 40.0 bits (92), Expect(2) = 7e-27 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 702 AYLINRMPSRVLKFQTPCQTL 722 >emb|CAN60373.1| hypothetical protein VITISV_034932 [Vitis vinifera] Length = 1264 Score = 107 bits (266), Expect(2) = 7e-27 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 593 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 652 Query: 256 MDV 264 MDV Sbjct: 653 MDV 655 Score = 40.0 bits (92), Expect(2) = 7e-27 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 566 AYLINRMPSRVLKFQTPCQTL 586 >emb|CAN62019.1| hypothetical protein VITISV_019561 [Vitis vinifera] Length = 692 Score = 107 bits (266), Expect(2) = 8e-27 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 111 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 170 Query: 256 MDV 264 MDV Sbjct: 171 MDV 173 Score = 40.0 bits (92), Expect(2) = 8e-27 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 84 AYLINRMPSRVLKFQTPCQTL 104 >emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera] Length = 1180 Score = 106 bits (265), Expect(2) = 1e-26 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 457 TRLISTVPPKIFGCSXFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 516 Query: 256 MDV 264 MDV Sbjct: 517 MDV 519 Score = 40.0 bits (92), Expect(2) = 1e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 430 AYLINRMPSRVLKFQTPCQTL 450 >emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera] Length = 1239 Score = 105 bits (263), Expect(2) = 2e-26 Identities = 45/63 (71%), Positives = 56/63 (88%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 532 TRLISTVPPKIFGCFVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 591 Query: 256 MDV 264 MDV Sbjct: 592 MDV 594 Score = 40.0 bits (92), Expect(2) = 2e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 505 AYLINRMPSRVLKFQTPCQTL 525 >emb|CAN73765.1| hypothetical protein VITISV_035279 [Vitis vinifera] Length = 2260 Score = 107 bits (266), Expect(2) = 2e-26 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 1537 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 1596 Query: 256 MDV 264 MDV Sbjct: 1597 MDV 1599 Score = 38.5 bits (88), Expect(2) = 2e-26 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 6 YLINRMPSRFLNFQTPCQVV 65 YLINRMPSR L FQTPCQ + Sbjct: 1511 YLINRMPSRVLKFQTPCQTL 1530 >emb|CAN65095.1| hypothetical protein VITISV_011639 [Vitis vinifera] Length = 1377 Score = 105 bits (261), Expect(2) = 3e-26 Identities = 44/63 (69%), Positives = 55/63 (87%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TR IS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN Sbjct: 714 TRFISTIPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNL 773 Query: 256 MDV 264 MDV Sbjct: 774 MDV 776 Score = 40.0 bits (92), Expect(2) = 3e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 687 AYLINRMPSRVLKFQTPCQTL 707 >emb|CAN71505.1| hypothetical protein VITISV_021018 [Vitis vinifera] Length = 1157 Score = 106 bits (264), Expect(2) = 3e-26 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+AFVH Q +++KL+PR++ C+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 500 TRLISTVPPKIFGCSAFVHINQQHRSKLDPRSLMCIFLGYSSNQKGYKCYSPVTRKFYNS 559 Query: 256 MDV 264 MDV Sbjct: 560 MDV 562 Score = 38.9 bits (89), Expect(2) = 3e-26 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPS+ L FQTPCQ + Sbjct: 473 AYLINRMPSKVLKFQTPCQTL 493 >emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera] Length = 1636 Score = 104 bits (260), Expect(2) = 4e-26 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS QKGYKCYSP+TRKFYN+ Sbjct: 738 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSKQKGYKCYSPVTRKFYNS 797 Query: 256 MDV 264 MDV Sbjct: 798 MDV 800 Score = 40.0 bits (92), Expect(2) = 4e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 711 AYLINRMPSRVLKFQTPCQTL 731 >emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera] Length = 1576 Score = 106 bits (265), Expect(2) = 4e-26 Identities = 44/63 (69%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++K++PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 853 TRLISTVPPKIFGCSVFVHINQQHRSKJDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 912 Query: 256 MDV 264 MDV Sbjct: 913 MDV 915 Score = 38.1 bits (87), Expect(2) = 4e-26 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMP R L FQTPCQ + Sbjct: 826 AYLINRMPXRVLKFQTPCQTL 846 >emb|CAN67245.1| hypothetical protein VITISV_008680 [Vitis vinifera] Length = 1333 Score = 104 bits (260), Expect(2) = 4e-26 Identities = 44/63 (69%), Positives = 56/63 (88%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCY P+TRKFYN+ Sbjct: 1029 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYFPVTRKFYNS 1088 Query: 256 MDV 264 MDV Sbjct: 1089 MDV 1091 Score = 40.0 bits (92), Expect(2) = 4e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 1002 AYLINRMPSRVLKFQTPCQTL 1022 >emb|CAN66669.1| hypothetical protein VITISV_032496 [Vitis vinifera] Length = 450 Score = 104 bits (259), Expect(2) = 5e-26 Identities = 47/71 (66%), Positives = 59/71 (83%) Frame = +1 Query: 52 LVKLFVHNTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSP 231 L+K F TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC FLGY NQKGYKCYSP Sbjct: 139 LLKSF-QTTRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCTFLGYFSNQKGYKCYSP 197 Query: 232 LTRKFYNTMDV 264 +TRKFYN+MDV Sbjct: 198 VTRKFYNSMDV 208 Score = 40.0 bits (92), Expect(2) = 5e-26 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRMPSR L FQTPCQ + Sbjct: 119 AYLINRMPSRVLKFQTPCQTL 139 >emb|CAN73399.1| hypothetical protein VITISV_006541 [Vitis vinifera] Length = 834 Score = 107 bits (266), Expect(2) = 6e-26 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 111 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 170 Query: 256 MDV 264 MDV Sbjct: 171 MDV 173 Score = 37.0 bits (84), Expect(2) = 6e-26 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRM SR L FQTPCQ + Sbjct: 84 AYLINRMXSRVLKFQTPCQTL 104 >emb|CAN82505.1| hypothetical protein VITISV_039312 [Vitis vinifera] Length = 397 Score = 107 bits (266), Expect(2) = 3e-25 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 111 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 170 Query: 256 MDV 264 MDV Sbjct: 171 MDV 173 Score = 34.7 bits (78), Expect(2) = 3e-25 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRM R L FQTPCQ + Sbjct: 84 AYLINRMSYRVLKFQTPCQTL 104 >emb|CAN76465.1| hypothetical protein VITISV_007267 [Vitis vinifera] Length = 701 Score = 107 bits (266), Expect(2) = 2e-23 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +1 Query: 76 TRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYNT 255 TRLIS +PPK+FGC+ FVH Q +++KL+PR++KC+FLGYS NQKGYKCYSP+TRKFYN+ Sbjct: 22 TRLISTVPPKIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSNQKGYKCYSPVTRKFYNS 81 Query: 256 MDV 264 MDV Sbjct: 82 MDV 84 Score = 28.5 bits (62), Expect(2) = 2e-23 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 21 MPSRFLNFQTPCQVV 65 MPSR L FQTPCQ + Sbjct: 1 MPSRVLKFQTPCQTL 15 >emb|CAN75434.1| hypothetical protein VITISV_027911 [Vitis vinifera] Length = 1162 Score = 94.7 bits (234), Expect(2) = 3e-23 Identities = 42/64 (65%), Positives = 55/64 (85%) Frame = +1 Query: 73 NTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYN 252 NTRLIS +P KVFGC+AFVH Q +++KL+PRA+KC+FLGYS QKGYKCYSP+ ++F + Sbjct: 408 NTRLISTIPFKVFGCSAFVHVHQQHRDKLDPRALKCIFLGYSPTQKGYKCYSPVIKQFDH 467 Query: 253 TMDV 264 +MDV Sbjct: 468 SMDV 471 Score = 40.4 bits (93), Expect(2) = 3e-23 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 6 YLINRMPSRFLNFQTPCQVV 65 YLINRMPSR L+FQTPCQ++ Sbjct: 383 YLINRMPSRILDFQTPCQIL 402 >ref|XP_004513812.1| PREDICTED: uncharacterized protein LOC101489272 [Cicer arietinum] Length = 758 Score = 98.2 bits (243), Expect(2) = 6e-23 Identities = 39/71 (54%), Positives = 60/71 (84%) Frame = +1 Query: 52 LVKLFVHNTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSP 231 L+ ++ H +++S +PPKVFGCTAFVH+ QPN+ KL P+++KC+FLGY N+KG++CY P Sbjct: 624 LLSIYPH-IKILSSIPPKVFGCTAFVHDNQPNKGKLEPKSLKCIFLGYPPNKKGHRCYYP 682 Query: 232 LTRKFYNTMDV 264 +++KFY++MDV Sbjct: 683 ISKKFYHSMDV 693 Score = 35.8 bits (81), Expect(2) = 6e-23 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 +YLINRMPS+ L F+TPCQ + Sbjct: 604 SYLINRMPSKALKFKTPCQTL 624 >emb|CAN80061.1| hypothetical protein VITISV_007942 [Vitis vinifera] Length = 960 Score = 92.8 bits (229), Expect(2) = 3e-22 Identities = 41/64 (64%), Positives = 53/64 (82%) Frame = +1 Query: 73 NTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYN 252 NT LIS +P KVFGC AFVH Q +++KL+PRA+KC+FL YS QKGYKCYSP+ ++FY+ Sbjct: 235 NTHLISTIPFKVFGCLAFVHVHQQHRDKLDPRALKCIFLWYSPTQKGYKCYSPVIKQFYH 294 Query: 253 TMDV 264 +MDV Sbjct: 295 SMDV 298 Score = 38.9 bits (89), Expect(2) = 3e-22 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +3 Query: 3 AYLINRMPSRFLNFQTPCQVV 65 AYLINRM SR L+FQTPCQ++ Sbjct: 209 AYLINRMSSRILDFQTPCQIL 229 >ref|XP_010113352.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus notabilis] gi|587949157|gb|EXC35359.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus notabilis] Length = 3263 Score = 96.3 bits (238), Expect(2) = 2e-21 Identities = 43/71 (60%), Positives = 55/71 (77%) Frame = +1 Query: 52 LVKLFVHNTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSP 231 L++ F H + S LPPKVFGCTAFVH +++K +PRA KC+FLGYS QKGYKCYSP Sbjct: 730 LLENFPHTRAVSSDLPPKVFGCTAFVHVYPQHRSKFDPRANKCIFLGYSPTQKGYKCYSP 789 Query: 232 LTRKFYNTMDV 264 ++++FY TMDV Sbjct: 790 ISKRFYTTMDV 800 Score = 32.7 bits (73), Expect(2) = 2e-21 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +3 Query: 6 YLINRMPSRFLNFQTPCQVV 65 YLINRMPSR L FQ+P Q++ Sbjct: 711 YLINRMPSRVLTFQSPRQLL 730 >emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera] Length = 1360 Score = 89.7 bits (221), Expect(2) = 3e-21 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +1 Query: 73 NTRLISILPPKVFGCTAFVHNKQPNQNKLNPRAIKCLFLGYSLNQKGYKCYSPLTRKFYN 252 + R+I + KVFGCTAFVH + +KL+P A KC+FLGYS NQKGYKCYSP T+KFY Sbjct: 667 SARIIXSIXIKVFGCTAFVHIHKSQHSKLDPTATKCIFLGYSPNQKGYKCYSPTTKKFYT 726 Query: 253 TMDV 264 +MDV Sbjct: 727 SMDV 730 Score = 38.5 bits (88), Expect(2) = 3e-21 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +3 Query: 6 YLINRMPSRFLNFQTPCQVV 65 YLINRMPSR L F+TPCQ++ Sbjct: 642 YLINRMPSRILQFKTPCQIL 661