BLASTX nr result
ID: Anemarrhena21_contig00070736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070736 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE07502.1| 26s proteasome regulatory subunit-like protein [O... 110 5e-22 gb|KKP01813.1| hypothetical protein THAR02_06069 [Trichoderma ha... 107 3e-21 gb|EHK48395.1| hypothetical protein TRIATDRAFT_53983 [Trichoderm... 107 3e-21 gb|EHK17813.1| hypothetical protein TRIVIDRAFT_183171 [Trichoder... 107 3e-21 ref|XP_006969776.1| predicted protein [Trichoderma reesei QM6a] ... 107 3e-21 gb|EWZ35483.1| hypothetical protein FOZG_11399 [Fusarium oxyspor... 106 5e-21 gb|EWY85036.1| hypothetical protein FOYG_12325 [Fusarium oxyspor... 106 5e-21 gb|EWG52729.1| hypothetical protein FVEG_11376 [Fusarium vertici... 106 5e-21 gb|KLO96805.1| 26S proteasome subunit RPN4 [Fusarium fujikuroi] 106 5e-21 gb|KIL88945.1| zinc finger protein rsv2 [Fusarium avenaceum] 106 5e-21 gb|EXK35152.1| hypothetical protein FOMG_10375 [Fusarium oxyspor... 106 5e-21 emb|CCT73456.1| related to 26S proteasome subunit RPN4 [Fusarium... 106 5e-21 gb|ENH74193.1| Zinc finger protein rsv2 [Fusarium oxysporum f. s... 106 5e-21 gb|EMT62354.1| Zinc finger protein rsv2 [Fusarium oxysporum f. s... 106 5e-21 gb|EGU86825.1| hypothetical protein FOXB_02652 [Fusarium oxyspor... 106 5e-21 ref|XP_003048469.1| hypothetical protein NECHADRAFT_71246 [Nectr... 106 7e-21 gb|EWZ96519.1| hypothetical protein FOWG_03882 [Fusarium oxyspor... 105 9e-21 gb|EXL55022.1| hypothetical protein FOCG_05736 [Fusarium oxyspor... 105 9e-21 ref|XP_011321329.1| hypothetical protein FGSG_04288 [Fusarium gr... 105 1e-20 ref|XP_009256202.1| hypothetical protein FPSE_04809 [Fusarium ps... 105 1e-20 >gb|EPE07502.1| 26s proteasome regulatory subunit-like protein [Ophiostoma piceae UAMH 11346] Length = 707 Score = 110 bits (274), Expect = 5e-22 Identities = 49/55 (89%), Positives = 51/55 (92%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGSG 165 RHEDTIHNA+KQKVRCNLCTEEKTFSRADALTRH+RVCHPEVE GKHRKR G G Sbjct: 649 RHEDTIHNARKQKVRCNLCTEEKTFSRADALTRHFRVCHPEVEFTGKHRKRGGGG 703 >gb|KKP01813.1| hypothetical protein THAR02_06069 [Trichoderma harzianum] Length = 662 Score = 107 bits (267), Expect = 3e-21 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNAKKQKV CNLCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 609 RHEDTIHNAKKQKVHCNLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRGGA 662 >gb|EHK48395.1| hypothetical protein TRIATDRAFT_53983 [Trichoderma atroviride IMI 206040] Length = 562 Score = 107 bits (267), Expect = 3e-21 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNAKKQKV CNLCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 509 RHEDTIHNAKKQKVHCNLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRGGA 562 >gb|EHK17813.1| hypothetical protein TRIVIDRAFT_183171 [Trichoderma virens Gv29-8] Length = 629 Score = 107 bits (267), Expect = 3e-21 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNAKKQKV CNLCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 576 RHEDTIHNAKKQKVHCNLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRGGA 629 >ref|XP_006969776.1| predicted protein [Trichoderma reesei QM6a] gi|340514007|gb|EGR44278.1| predicted protein [Trichoderma reesei QM6a] gi|572273335|gb|ETR96986.1| hypothetical protein M419DRAFT_134910 [Trichoderma reesei RUT C-30] Length = 557 Score = 107 bits (267), Expect = 3e-21 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNAKKQKV CNLCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 504 RHEDTIHNAKKQKVHCNLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRGGA 557 >gb|EWZ35483.1| hypothetical protein FOZG_11399 [Fusarium oxysporum Fo47] Length = 602 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 602 >gb|EWY85036.1| hypothetical protein FOYG_12325 [Fusarium oxysporum FOSC 3-a] Length = 602 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 602 >gb|EWG52729.1| hypothetical protein FVEG_11376 [Fusarium verticillioides 7600] gi|584143427|gb|EWG52730.1| hypothetical protein FVEG_11376 [Fusarium verticillioides 7600] Length = 603 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 550 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 603 >gb|KLO96805.1| 26S proteasome subunit RPN4 [Fusarium fujikuroi] Length = 622 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 569 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 622 >gb|KIL88945.1| zinc finger protein rsv2 [Fusarium avenaceum] Length = 619 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 566 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 619 >gb|EXK35152.1| hypothetical protein FOMG_10375 [Fusarium oxysporum f. sp. melonis 26406] Length = 602 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 602 >emb|CCT73456.1| related to 26S proteasome subunit RPN4 [Fusarium fujikuroi IMI 58289] gi|829139225|gb|KLP12171.1| 26S proteasome subunit RPN4 [Fusarium fujikuroi] gi|829139705|gb|KLP12558.1| 26S proteasome subunit RPN4 [Fusarium fujikuroi] Length = 622 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 569 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 622 >gb|ENH74193.1| Zinc finger protein rsv2 [Fusarium oxysporum f. sp. cubense race 1] gi|587739894|gb|EXA37610.1| hypothetical protein FOVG_11755 [Fusarium oxysporum f. sp. pisi HDV247] gi|590058851|gb|EXK86375.1| hypothetical protein FOQG_10009 [Fusarium oxysporum f. sp. raphani 54005] gi|591447025|gb|EXL79477.1| hypothetical protein FOPG_06542 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591495371|gb|EXM24895.1| hypothetical protein FOTG_07945 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 602 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 602 >gb|EMT62354.1| Zinc finger protein rsv2 [Fusarium oxysporum f. sp. cubense race 4] gi|591474701|gb|EXM05890.1| hypothetical protein FOIG_04349 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 602 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 602 >gb|EGU86825.1| hypothetical protein FOXB_02652 [Fusarium oxysporum Fo5176] Length = 622 Score = 106 bits (265), Expect = 5e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 569 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRAGA 622 >ref|XP_003048469.1| hypothetical protein NECHADRAFT_71246 [Nectria haematococca mpVI 77-13-4] gi|256729402|gb|EEU42756.1| hypothetical protein NECHADRAFT_71246 [Nectria haematococca mpVI 77-13-4] Length = 602 Score = 106 bits (264), Expect = 7e-21 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VEL GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVELPGKHRRRGGA 602 >gb|EWZ96519.1| hypothetical protein FOWG_03882 [Fusarium oxysporum f. sp. lycopersici MN25] Length = 602 Score = 105 bits (263), Expect = 9e-21 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VE+ GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVEIPGKHRRRAGA 602 >gb|EXL55022.1| hypothetical protein FOCG_05736 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 602 Score = 105 bits (263), Expect = 9e-21 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP+VE+ GKHR+R G+ Sbjct: 549 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDVEIPGKHRRRAGA 602 >ref|XP_011321329.1| hypothetical protein FGSG_04288 [Fusarium graminearum PH-1] gi|558858747|gb|ESU08830.1| hypothetical protein FGSG_04288 [Fusarium graminearum PH-1] gi|596544697|gb|EYB24817.1| hypothetical protein FG05_04288 [Fusarium graminearum] gi|699040239|emb|CEF79265.1| unnamed protein product [Fusarium graminearum] Length = 618 Score = 105 bits (262), Expect = 1e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP++EL GKHR+R G+ Sbjct: 565 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDMELPGKHRRRAGA 618 >ref|XP_009256202.1| hypothetical protein FPSE_04809 [Fusarium pseudograminearum CS3096] gi|408395816|gb|EKJ74989.1| hypothetical protein FPSE_04809 [Fusarium pseudograminearum CS3096] Length = 599 Score = 105 bits (262), Expect = 1e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = +1 Query: 1 RHEDTIHNAKKQKVRCNLCTEEKTFSRADALTRHYRVCHPEVELLGKHRKRRGS 162 RHEDTIHNA+KQKVRC+LCTEEKTFSRADALTRHYRVCHP++EL GKHR+R G+ Sbjct: 546 RHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPDMELPGKHRRRAGA 599