BLASTX nr result
ID: Anemarrhena21_contig00070642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070642 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGO41822.1| Xanthine/uracil/vitamin C permease [Penicillium e... 77 6e-12 gb|EMF08215.1| hypothetical protein SEPMUDRAFT_152465 [Sphaeruli... 76 1e-11 ref|XP_007782163.1| hypothetical protein W97_06248 [Coniosporium... 75 1e-11 gb|KJJ12048.1| Xanthineuracilvitamin C permease [Penicillium sol... 75 2e-11 ref|XP_002384536.1| nucleoside transporter, putative [Aspergillu... 74 3e-11 emb|CDM28972.1| Xanthine/uracil/vitamin C permease [Penicillium ... 74 4e-11 ref|XP_008720606.1| hypothetical protein HMPREF1541_08064 [Cyphe... 74 4e-11 ref|XP_007799193.1| putative inner membrane protein yico protein... 74 4e-11 gb|KGO78183.1| Xanthine/uracil/vitamin C permease [Penicillium i... 74 5e-11 gb|EYE95713.1| hypothetical protein EURHEDRAFT_402397 [Aspergill... 73 8e-11 ref|XP_001827347.1| xanthine/uracil permease [Aspergillus oryzae... 73 8e-11 gb|EIT75820.1| permease [Aspergillus oryzae 3.042] gi|635509970|... 73 8e-11 gb|KIX01808.1| hypothetical protein Z518_09535 [Rhinocladiella m... 72 1e-10 ref|XP_007284185.1| purine transporter [Colletotrichum gloeospor... 72 1e-10 gb|KLT46368.1| permease [Trichosporon oleaginosus] 72 2e-10 gb|KJK67413.1| Permease family protein [Aspergillus parasiticus ... 71 2e-10 gb|KIW47658.1| hypothetical protein PV06_00331 [Exophiala oligos... 71 2e-10 gb|KIW31221.1| hypothetical protein PV07_02887 [Cladophialophora... 71 2e-10 gb|KFA73924.1| hypothetical protein S40288_00953 [Stachybotrys c... 71 2e-10 gb|KFA63347.1| hypothetical protein S40285_01800 [Stachybotrys c... 70 4e-10 >gb|KGO41822.1| Xanthine/uracil/vitamin C permease [Penicillium expansum] gi|700462086|gb|KGO51183.1| Xanthine/uracil/vitamin C permease [Penicillium expansum] gi|700488380|gb|KGO73664.1| Xanthine/uracil/vitamin C permease [Penicillium expansum] Length = 584 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -3 Query: 132 MAGWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 ++ WVHNTN+R+A++ VGK+FRLEGSGH ERKGSYFFTEIRAG Sbjct: 3 LSNWVHNTNVRVARSPVGKWFRLEGSGHPLERKGSYFFTEIRAG 46 >gb|EMF08215.1| hypothetical protein SEPMUDRAFT_152465 [Sphaerulina musiva SO2202] Length = 590 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 129 AGWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 + WV NTN +A+TA+GKYFRLEGSGH KERKG+YFFTEIRAG Sbjct: 4 SSWVRNTNAAVAKTAMGKYFRLEGSGHAKERKGTYFFTEIRAG 46 >ref|XP_007782163.1| hypothetical protein W97_06248 [Coniosporium apollinis CBS 100218] gi|494830282|gb|EON66846.1| hypothetical protein W97_06248 [Coniosporium apollinis CBS 100218] Length = 579 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GWVHN NL IA+ VG+YFRL+GSGH KERKGSYFFTE+RAG Sbjct: 2 GWVHNANLAIARGPVGRYFRLDGSGHPKERKGSYFFTELRAG 43 >gb|KJJ12048.1| Xanthineuracilvitamin C permease [Penicillium solitum] Length = 584 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 132 MAGWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 ++ WVH+TN+R+A++ VGK+FRLEGSGH ERKGSYFFTEIRAG Sbjct: 3 LSSWVHDTNVRVARSPVGKWFRLEGSGHPLERKGSYFFTEIRAG 46 >ref|XP_002384536.1| nucleoside transporter, putative [Aspergillus flavus NRRL3357] gi|220689249|gb|EED45600.1| nucleoside transporter, putative [Aspergillus flavus NRRL3357] Length = 571 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+H TNL++AQT VG++FRLE SGH +ERKGS+FFTEIRAG Sbjct: 2 GWIHRTNLKVAQTPVGRWFRLENSGHPQERKGSFFFTEIRAG 43 >emb|CDM28972.1| Xanthine/uracil/vitamin C permease [Penicillium roqueforti FM164] Length = 583 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 129 AGWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 A WVH TN+R+A++ VG +FRLEGSGH +ERKGSYFFTEIRAG Sbjct: 4 ANWVHKTNVRVARSPVGTWFRLEGSGHPRERKGSYFFTEIRAG 46 >ref|XP_008720606.1| hypothetical protein HMPREF1541_08064 [Cyphellophora europaea CBS 101466] gi|568114452|gb|ETN37074.1| hypothetical protein HMPREF1541_08064 [Cyphellophora europaea CBS 101466] Length = 586 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+HNTN +A++ VG+ FRLEGSGH KERKGSYFFTEIRAG Sbjct: 2 GWIHNTNAAVARSFVGRRFRLEGSGHPKERKGSYFFTEIRAG 43 >ref|XP_007799193.1| putative inner membrane protein yico protein [Eutypa lata UCREL1] gi|471559286|gb|EMR61726.1| putative inner membrane protein yico protein [Eutypa lata UCREL1] Length = 579 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+H+TNL++A++ VG++FRLEG GH +ERKGSYFFTEIRAG Sbjct: 2 GWIHDTNLKVAKSPVGRWFRLEGCGHPRERKGSYFFTEIRAG 43 >gb|KGO78183.1| Xanthine/uracil/vitamin C permease [Penicillium italicum] Length = 584 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 123 WVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 WVH+TN+R+A++ VGK+FRLEGSGH ERKGSYFFTEIRAG Sbjct: 6 WVHDTNVRVARSPVGKWFRLEGSGHPLERKGSYFFTEIRAG 46 >gb|EYE95713.1| hypothetical protein EURHEDRAFT_402397 [Aspergillus ruber CBS 135680] Length = 594 Score = 72.8 bits (177), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -3 Query: 123 WVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 WVH NL +A++ VGK+FRLEGSGH KERKGSYFFTEIRAG Sbjct: 9 WVHRVNLSVARSPVGKHFRLEGSGHPKERKGSYFFTEIRAG 49 >ref|XP_001827347.1| xanthine/uracil permease [Aspergillus oryzae RIB40] gi|83776095|dbj|BAE66214.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 571 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+H TNL++AQ+ VG++FRLE SGH +ERKGS+FFTEIRAG Sbjct: 2 GWIHRTNLKVAQSPVGRWFRLENSGHPQERKGSFFFTEIRAG 43 >gb|EIT75820.1| permease [Aspergillus oryzae 3.042] gi|635509970|gb|KDE81916.1| permease [Aspergillus oryzae 100-8] Length = 571 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+H TNL++AQ+ VG++FRLE SGH +ERKGS+FFTEIRAG Sbjct: 2 GWIHRTNLKVAQSPVGRWFRLENSGHPQERKGSFFFTEIRAG 43 >gb|KIX01808.1| hypothetical protein Z518_09535 [Rhinocladiella mackenziei CBS 650.93] Length = 588 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 123 WVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 W+HNTNL +A++ VG+ FRL+GSGH KERKGSYFFTEIRAG Sbjct: 6 WIHNTNLAVARSFVGRRFRLDGSGHPKERKGSYFFTEIRAG 46 >ref|XP_007284185.1| purine transporter [Colletotrichum gloeosporioides Nara gc5] gi|429851552|gb|ELA26737.1| purine transporter [Colletotrichum gloeosporioides Nara gc5] Length = 584 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+HN N +IA + VG++F+LEGSGH +ERKGSYFFTEIRAG Sbjct: 2 GWIHNANAKIAASPVGRWFQLEGSGHPRERKGSYFFTEIRAG 43 >gb|KLT46368.1| permease [Trichosporon oleaginosus] Length = 584 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GWV N+ +AQ+AVG+YFRL+GSGHRKERK ++FFTEIRAG Sbjct: 2 GWVSRANIAVAQSAVGRYFRLQGSGHRKERKNTFFFTEIRAG 43 >gb|KJK67413.1| Permease family protein [Aspergillus parasiticus SU-1] Length = 571 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GW+H TNL++A++ VG++FRLE SGH +ERKGS+FFTEIRAG Sbjct: 2 GWIHRTNLKVARSPVGRWFRLENSGHPQERKGSFFFTEIRAG 43 >gb|KIW47658.1| hypothetical protein PV06_00331 [Exophiala oligosperma] Length = 613 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -3 Query: 123 WVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 W+HN N+ +A++ VGK FRL+GSGHR+ERKG+YFFTEIRAG Sbjct: 6 WIHNANMAVARSFVGKRFRLDGSGHRRERKGTYFFTEIRAG 46 >gb|KIW31221.1| hypothetical protein PV07_02887 [Cladophialophora immunda] gi|759254559|gb|KIW31222.1| hypothetical protein, variant [Cladophialophora immunda] Length = 604 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -3 Query: 123 WVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 W+HN N+ +A++ VGK FRL+GSGHR+ERKG+YFFTEIRAG Sbjct: 6 WIHNANMAVARSFVGKRFRLDGSGHRRERKGTYFFTEIRAG 46 >gb|KFA73924.1| hypothetical protein S40288_00953 [Stachybotrys chartarum IBT 40288] Length = 598 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GWVH N R+A + VG++F+LEGSGH KERKGSYFFTE+RAG Sbjct: 2 GWVHKVNQRVATSPVGRWFKLEGSGHPKERKGSYFFTELRAG 43 >gb|KFA63347.1| hypothetical protein S40285_01800 [Stachybotrys chlorohalonata IBT 40285] Length = 598 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 126 GWVHNTNLRIAQTAVGKYFRLEGSGHRKERKGSYFFTEIRAG 1 GWVH N R+A + VG++F+LEGSGH KERKGSYFFTE RAG Sbjct: 2 GWVHKVNQRVATSPVGRWFKLEGSGHPKERKGSYFFTEFRAG 43