BLASTX nr result
ID: Anemarrhena21_contig00070465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070465 (226 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008775712.1| PREDICTED: AP2-like ethylene-responsive tran... 58 3e-06 >ref|XP_008775712.1| PREDICTED: AP2-like ethylene-responsive transcription factor At1g16060 [Phoenix dactylifera] Length = 406 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +3 Query: 9 YNGILYEGTADGPCIYSSHSDNATTGEIEERTPYYDRNEQGIWNGVLGI 155 Y GILYEG AD P YS DN E++E YYD++EQ IWNGV+ + Sbjct: 354 YQGILYEGIADMPYGYSPDGDNGRRIELQESVSYYDQSEQSIWNGVVSM 402