BLASTX nr result
ID: Anemarrhena21_contig00070418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070418 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007911918.1| putative sodium phosphate protein [Togninia ... 91 3e-16 gb|EKG19498.1| Phosphate transporter [Macrophomina phaseolina MS6] 90 5e-16 gb|KJZ78891.1| hypothetical protein HIM_01664 [Hirsutella minnes... 90 7e-16 gb|KJZ67927.1| hypothetical protein HIM_12684 [Hirsutella minnes... 90 7e-16 ref|XP_008084618.1| sodium/phosphate symporter, putative [Glarea... 90 7e-16 ref|XP_006969340.1| predicted protein [Trichoderma reesei QM6a] ... 90 7e-16 gb|KKY23335.1| putative sodium phosphate [Diplodia seriata] 89 9e-16 ref|XP_007595491.1| phosphate transporter [Colletotrichum fiorin... 89 9e-16 gb|EQB47272.1| phosphate transporter [Colletotrichum gloeosporio... 89 9e-16 gb|ENH84486.1| sodium phosphate [Colletotrichum orbiculare MAFF ... 89 9e-16 ref|XP_007272754.1| sodium phosphate [Colletotrichum gloeosporio... 89 9e-16 ref|XP_003657330.1| hypothetical protein THITE_2132391 [Thielavi... 89 9e-16 ref|XP_008095123.1| phosphate transporter [Colletotrichum gramin... 89 9e-16 gb|KKY30265.1| putative sodium phosphate [Diaporthe ampelina] 89 1e-15 ref|XP_001399156.2| sodium/phosphate symporter [Aspergillus nige... 89 1e-15 emb|CAK96233.1| unnamed protein product [Aspergillus niger] gi|3... 89 1e-15 ref|XP_001261586.1| sodium/phosphate symporter, putative [Neosar... 89 1e-15 gb|KIW53111.1| hypothetical protein PV05_08707 [Exophiala xenobi... 89 1e-15 gb|KEY81252.1| sodium/phosphate symporter [Aspergillus fumigatus... 88 2e-15 gb|KEQ98778.1| hypothetical protein AUEXF2481DRAFT_1613 [Aureoba... 88 2e-15 >ref|XP_007911918.1| putative sodium phosphate protein [Togninia minima UCRPA7] gi|500260836|gb|EOO03359.1| putative sodium phosphate protein [Togninia minima UCRPA7] Length = 610 Score = 90.9 bits (224), Expect = 3e-16 Identities = 45/58 (77%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+LSW G+LMGLFLNAPHFA Sbjct: 551 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLSWIMTIPIAGTLGGILMGLFLNAPHFA 608 >gb|EKG19498.1| Phosphate transporter [Macrophomina phaseolina MS6] Length = 602 Score = 90.1 bits (222), Expect = 5e-16 Identities = 45/57 (78%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV+SW GVLMGLFLNAPHF Sbjct: 545 SMCITGATVGVGLCNGTLKAVNFQRVGLLVISWIMTIPIAGTLGGVLMGLFLNAPHF 601 >gb|KJZ78891.1| hypothetical protein HIM_01664 [Hirsutella minnesotensis 3608] Length = 615 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/57 (78%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLL+LSW GVLMGLFLNAPHF Sbjct: 558 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLSWIATIPIAGTIGGVLMGLFLNAPHF 614 >gb|KJZ67927.1| hypothetical protein HIM_12684 [Hirsutella minnesotensis 3608] Length = 448 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/57 (78%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLL+LSW GVLMGLFLNAPHF Sbjct: 391 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLSWIATIPIAGTIGGVLMGLFLNAPHF 447 >ref|XP_008084618.1| sodium/phosphate symporter, putative [Glarea lozoyensis ATCC 20868] gi|361126538|gb|EHK98533.1| putative Phosphate-repressible phosphate permease [Glarea lozoyensis 74030] gi|512199877|gb|EPE28710.1| sodium/phosphate symporter, putative [Glarea lozoyensis ATCC 20868] Length = 598 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/57 (78%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLL+LSW GVLMGLFLNAPHF Sbjct: 542 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLSWIATIPIAGTLGGVLMGLFLNAPHF 598 >ref|XP_006969340.1| predicted protein [Trichoderma reesei QM6a] gi|340514484|gb|EGR44746.1| predicted protein [Trichoderma reesei QM6a] gi|572274042|gb|ETR97610.1| putative sodium/phosphate symporter [Trichoderma reesei RUT C-30] Length = 609 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/58 (77%), Positives = 46/58 (79%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+ SW GVLMGLFLNAPHFA Sbjct: 546 SMCITGATVGVGLCNGTLKAVNFQRVGLLLFSWIMTIPIAGTLGGVLMGLFLNAPHFA 603 >gb|KKY23335.1| putative sodium phosphate [Diplodia seriata] Length = 604 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 547 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTIGGVLMGLFLNAPHF 603 >ref|XP_007595491.1| phosphate transporter [Colletotrichum fioriniae PJ7] gi|588900257|gb|EXF80938.1| phosphate transporter [Colletotrichum fioriniae PJ7] Length = 558 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 502 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTLGGVLMGLFLNAPHF 558 >gb|EQB47272.1| phosphate transporter [Colletotrichum gloeosporioides Cg-14] Length = 604 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 548 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTLGGVLMGLFLNAPHF 604 >gb|ENH84486.1| sodium phosphate [Colletotrichum orbiculare MAFF 240422] Length = 601 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 545 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTLGGVLMGLFLNAPHF 601 >ref|XP_007272754.1| sodium phosphate [Colletotrichum gloeosporioides Nara gc5] gi|429863905|gb|ELA38312.1| sodium phosphate [Colletotrichum gloeosporioides Nara gc5] Length = 604 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 548 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTLGGVLMGLFLNAPHF 604 >ref|XP_003657330.1| hypothetical protein THITE_2132391 [Thielavia terrestris NRRL 8126] gi|347004596|gb|AEO70994.1| hypothetical protein THITE_2132391 [Thielavia terrestris NRRL 8126] Length = 587 Score = 89.4 bits (220), Expect = 9e-16 Identities = 44/58 (75%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTL+AVNFQRVGLL+LSW GVLMGLF+NAPHFA Sbjct: 530 SMCITGATVGVGLCNGTLRAVNFQRVGLLLLSWIATIPIAGTLAGVLMGLFINAPHFA 587 >ref|XP_008095123.1| phosphate transporter [Colletotrichum graminicola M1.001] gi|310795642|gb|EFQ31103.1| phosphate transporter [Colletotrichum graminicola M1.001] Length = 606 Score = 89.4 bits (220), Expect = 9e-16 Identities = 45/57 (78%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV SW GVLMGLFLNAPHF Sbjct: 550 SMCITGATVGVGLCNGTLKAVNFQRVGLLVFSWIMTIPVAGTLGGVLMGLFLNAPHF 606 >gb|KKY30265.1| putative sodium phosphate [Diaporthe ampelina] Length = 598 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLLV++W GVLMGLFLNAPHF Sbjct: 540 SMCITGATVGVGLCNGTLKAVNFQRVGLLVIAWIATIPIAGTLGGVLMGLFLNAPHF 596 >ref|XP_001399156.2| sodium/phosphate symporter [Aspergillus niger CBS 513.88] Length = 597 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+L+W G+LMGLF+NAPHFA Sbjct: 539 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLAWIMTIPIAGTLGGILMGLFINAPHFA 596 >emb|CAK96233.1| unnamed protein product [Aspergillus niger] gi|350634196|gb|EHA22558.1| phosphate transporter [Aspergillus niger ATCC 1015] Length = 608 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+L+W G+LMGLF+NAPHFA Sbjct: 550 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLAWIMTIPIAGTLGGILMGLFINAPHFA 607 >ref|XP_001261586.1| sodium/phosphate symporter, putative [Neosartorya fischeri NRRL 181] gi|119409741|gb|EAW19689.1| sodium/phosphate symporter, putative [Neosartorya fischeri NRRL 181] Length = 613 Score = 89.0 bits (219), Expect = 1e-15 Identities = 44/58 (75%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+L+W GVLMGLFLNAPHF+ Sbjct: 555 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLAWIMTIPIAGTLGGVLMGLFLNAPHFS 612 >gb|KIW53111.1| hypothetical protein PV05_08707 [Exophiala xenobiotica] Length = 597 Score = 88.6 bits (218), Expect = 1e-15 Identities = 44/57 (77%), Positives = 46/57 (80%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGTLKAVNFQRVGLL+L+W GVLMGLFLNAPHF Sbjct: 539 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLAWLLTIPIAGTLGGVLMGLFLNAPHF 595 >gb|KEY81252.1| sodium/phosphate symporter [Aspergillus fumigatus var. RP-2014] Length = 613 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHFA 111 SMCITGATVGVGLCNGTLKAVNFQRVGLL+L+W GVLMGLF+NAPHF+ Sbjct: 555 SMCITGATVGVGLCNGTLKAVNFQRVGLLLLAWIMTIPIAGTLGGVLMGLFINAPHFS 612 >gb|KEQ98778.1| hypothetical protein AUEXF2481DRAFT_1613 [Aureobasidium subglaciale EXF-2481] Length = 603 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/57 (77%), Positives = 45/57 (78%) Frame = -2 Query: 284 SMCITGATVGVGLCNGTLKAVNFQRVGLLVLSWXXXXXXXXXXXGVLMGLFLNAPHF 114 SMCITGATVGVGLCNGT KAVNFQRVGLL+LSW GVLMGLFLNAPHF Sbjct: 545 SMCITGATVGVGLCNGTFKAVNFQRVGLLLLSWIMTIPVAGTLGGVLMGLFLNAPHF 601