BLASTX nr result
ID: Anemarrhena21_contig00070406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070406 (207 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY24283.1| putative glucosamine-fructose-6-phosphate aminotr... 77 4e-12 ref|XP_007589370.1| putative glucosamine-fructose-6-phosphate am... 77 4e-12 gb|EKG14759.1| Glutamine amidotransferase class-2 [Macrophomina ... 77 4e-12 gb|KIW01630.1| glutamine-fructose-6-phosphate transaminase (isom... 76 8e-12 gb|KKY22646.1| putative glucosamine--fructose-6-phosphate aminot... 76 1e-11 dbj|GAO87701.1| glutamine--fructose-6-phosphate aminotransferase... 75 1e-11 gb|KKZ60396.1| glucosamine-fructose-6-phosphate aminotransferase... 75 1e-11 dbj|GAM36841.1| Gfa1 homolog [Talaromyces cellulolyticus] 75 1e-11 gb|KFX45180.1| Glutamine--fructose-6-phosphate aminotransferase ... 75 1e-11 ref|XP_003019512.1| hypothetical protein TRV_06467 [Trichophyton... 75 1e-11 ref|XP_003012723.1| hypothetical protein ARB_00974 [Arthroderma ... 75 1e-11 ref|XP_002480787.1| glucosamine-fructose-6-phosphate aminotransf... 75 1e-11 ref|XP_002151819.1| glucosamine-fructose-6-phosphate aminotransf... 75 1e-11 gb|EZF28742.1| glutamine-fructose-6-phosphate transaminase (isom... 75 1e-11 gb|EZF13157.1| glutamine-fructose-6-phosphate transaminase (isom... 75 1e-11 gb|EYE93508.1| glutamine:fructose-6-phosphate amidotransferase [... 75 1e-11 ref|XP_750525.1| glucosamine-fructose-6-phosphate aminotransfera... 75 1e-11 dbj|GAD98508.1| glucosamine--fructose-6-phosphate aminotransfera... 75 1e-11 ref|XP_007780317.1| glucosamine-fructose-6-phosphate aminotransf... 75 1e-11 ref|XP_007586373.1| putative glucosamine-fructose-6-phosphate am... 75 1e-11 >gb|KKY24283.1| putative glucosamine-fructose-6-phosphate aminotransferase [Diplodia seriata] Length = 686 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 650 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 686 >ref|XP_007589370.1| putative glucosamine-fructose-6-phosphate aminotransferase protein [Neofusicoccum parvum UCRNP2] gi|485915549|gb|EOD43159.1| putative glucosamine-fructose-6-phosphate aminotransferase protein [Neofusicoccum parvum UCRNP2] Length = 684 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 648 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 684 >gb|EKG14759.1| Glutamine amidotransferase class-2 [Macrophomina phaseolina MS6] Length = 689 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 653 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 689 >gb|KIW01630.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Verruconis gallopava] Length = 693 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGL+NVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 657 QGLINVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 693 >gb|KKY22646.1| putative glucosamine--fructose-6-phosphate aminotransferase [Phaeomoniella chlamydospora] Length = 689 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQLM+YWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 653 QGLLNVIPLQLMSYWLAVGEGLNVDFPRNLAKSVTVE 689 >dbj|GAO87701.1| glutamine--fructose-6-phosphate aminotransferase [isomerizing] [Neosartorya udagawae] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >gb|KKZ60396.1| glucosamine-fructose-6-phosphate aminotransferase [Emmonsia crescens UAMH 3008] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >dbj|GAM36841.1| Gfa1 homolog [Talaromyces cellulolyticus] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >gb|KFX45180.1| Glutamine--fructose-6-phosphate aminotransferase [isomerizing] [Talaromyces marneffei PM1] Length = 679 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 643 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 679 >ref|XP_003019512.1| hypothetical protein TRV_06467 [Trichophyton verrucosum HKI 0517] gi|291183241|gb|EFE38867.1| hypothetical protein TRV_06467 [Trichophyton verrucosum HKI 0517] Length = 921 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 885 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 921 >ref|XP_003012723.1| hypothetical protein ARB_00974 [Arthroderma benhamiae CBS 112371] gi|291176283|gb|EFE32083.1| hypothetical protein ARB_00974 [Arthroderma benhamiae CBS 112371] Length = 839 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 803 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 839 >ref|XP_002480787.1| glucosamine-fructose-6-phosphate aminotransferase [Talaromyces stipitatus ATCC 10500] gi|218720934|gb|EED20353.1| glucosamine-fructose-6-phosphate aminotransferase [Talaromyces stipitatus ATCC 10500] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >ref|XP_002151819.1| glucosamine-fructose-6-phosphate aminotransferase [Talaromyces marneffei ATCC 18224] gi|210066726|gb|EEA20819.1| glucosamine-fructose-6-phosphate aminotransferase [Talaromyces marneffei ATCC 18224] gi|679992542|gb|KFX45179.1| Glutamine--fructose-6-phosphate aminotransferase [isomerizing] [Talaromyces marneffei PM1] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >gb|EZF28742.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton interdigitale H6] gi|633047059|gb|KDB23614.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton interdigitale MR816] Length = 695 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 659 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 695 >gb|EZF13157.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum MR850] gi|607902087|gb|EZF39687.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 100081] gi|607914099|gb|EZF50211.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 288.86] gi|607926166|gb|EZF60843.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 289.86] gi|607937979|gb|EZF71361.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton soudanense CBS 452.61] gi|607950153|gb|EZF82170.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum MR1448] gi|607962373|gb|EZF92920.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum MR1459] gi|607974677|gb|EZG03932.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 735.88] gi|607986376|gb|EZG14495.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 202.88] gi|633056373|gb|KDB31420.1| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum D6] gi|674805683|gb|EGD85404.2| glutamine-fructose-6-phosphate transaminase (isomerizing) [Trichophyton rubrum CBS 118892] Length = 517 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 481 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 517 >gb|EYE93508.1| glutamine:fructose-6-phosphate amidotransferase [Aspergillus ruber CBS 135680] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLVAYWLAVGEGLNVDFPRNLAKSVTVE 694 >ref|XP_750525.1| glucosamine-fructose-6-phosphate aminotransferase [Aspergillus fumigatus Af293] gi|119467884|ref|XP_001257748.1| glucosamine-fructose-6-phosphate aminotransferase [Neosartorya fischeri NRRL 181] gi|48479738|gb|AAT44964.1| glucosamine-fructose-6-phosphate aminotransferase [Aspergillus fumigatus] gi|66848158|gb|EAL88487.1| glucosamine-fructose-6-phosphate aminotransferase [Aspergillus fumigatus Af293] gi|119405900|gb|EAW15851.1| glucosamine-fructose-6-phosphate aminotransferase [Neosartorya fischeri NRRL 181] gi|159124081|gb|EDP49199.1| glucosamine-fructose-6-phosphate aminotransferase [Aspergillus fumigatus A1163] gi|846917215|gb|KMK62962.1| glucosamine-fructose-6-phosphate aminotransferase [Aspergillus fumigatus Z5] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >dbj|GAD98508.1| glucosamine--fructose-6-phosphate aminotransferase [Byssochlamys spectabilis No. 5] Length = 694 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQL+AYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 658 QGLLNVIPLQLIAYWLAVGEGLNVDFPRNLAKSVTVE 694 >ref|XP_007780317.1| glucosamine-fructose-6-phosphate aminotransferase [Coniosporium apollinis CBS 100218] gi|494828128|gb|EON65000.1| glucosamine-fructose-6-phosphate aminotransferase [Coniosporium apollinis CBS 100218] Length = 693 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGL+NVIP+QLMAYWLAVGEGLNVDFPRNLAKSVTVE Sbjct: 657 QGLINVIPMQLMAYWLAVGEGLNVDFPRNLAKSVTVE 693 >ref|XP_007586373.1| putative glucosamine-fructose-6-phosphate aminotransferase protein [Neofusicoccum parvum UCRNP2] gi|485920008|gb|EOD46155.1| putative glucosamine-fructose-6-phosphate aminotransferase protein [Neofusicoccum parvum UCRNP2] Length = 197 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 207 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLAKSVTVE 97 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNL KSVTVE Sbjct: 161 QGLLNVIPLQLMAYWLAVGEGLNVDFPRNLTKSVTVE 197