BLASTX nr result
ID: Anemarrhena21_contig00070301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070301 (466 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580146.1| hypothetical protein UCRNP2_822 [Neofusicocc... 57 4e-06 gb|EKG18470.1| hypothetical protein MPH_04272 [Macrophomina phas... 57 6e-06 >ref|XP_007580146.1| hypothetical protein UCRNP2_822 [Neofusicoccum parvum UCRNP2] gi|485928730|gb|EOD52379.1| hypothetical protein UCRNP2_822 [Neofusicoccum parvum UCRNP2] Length = 375 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/44 (56%), Positives = 32/44 (72%) Frame = -2 Query: 135 PVTVVTNITSFVKCSTPVIEHGTTKYYSTWLTPTYIPSTDRKSV 4 P T+++ ITSFV CSTPV GT+ +YSTWLT T+IP T +V Sbjct: 213 PTTIISTITSFVPCSTPVGHEGTSTWYSTWLTATHIPHTTVSTV 256 >gb|EKG18470.1| hypothetical protein MPH_04272 [Macrophomina phaseolina MS6] Length = 374 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 135 PVTVVTNITSFVKCSTPVIEHGTTKYYSTWLTPTYIPST 19 P T+V +TSFV CSTPV GT +YSTWLT T+IP T Sbjct: 206 PTTIVNTVTSFVPCSTPVGHEGTNTWYSTWLTATFIPHT 244