BLASTX nr result
ID: Anemarrhena21_contig00070139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070139 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003835208.1| hypothetical protein LEMA_P045490.1 [Leptosp... 133 4e-29 ref|XP_001795751.1| hypothetical protein SNOG_05345 [Phaeosphaer... 120 3e-25 gb|KKY27401.1| putative c2h2 finger domain [Diplodia seriata] 105 2e-20 gb|EKG21305.1| Zinc finger C2H2-type protein [Macrophomina phase... 105 2e-20 ref|XP_007582438.1| putative c2h2 finger domain protein [Neofusi... 104 3e-20 ref|XP_007778088.1| hypothetical protein W97_01996 [Coniosporium... 100 3e-19 ref|XP_001934653.1| conserved hypothetical protein [Pyrenophora ... 96 1e-17 ref|XP_003296403.1| hypothetical protein PTT_06499 [Pyrenophora ... 94 4e-17 gb|EMD97765.1| hypothetical protein COCHEDRAFT_1221075 [Bipolari... 92 1e-16 ref|XP_007704329.1| hypothetical protein COCSADRAFT_248822 [Bipo... 91 2e-16 gb|EUN21776.1| hypothetical protein COCVIDRAFT_113106 [Bipolaris... 91 3e-16 ref|XP_007714303.1| hypothetical protein COCCADRAFT_101408 [Bipo... 91 3e-16 ref|XP_007683394.1| hypothetical protein COCMIDRAFT_22427 [Bipol... 91 4e-16 ref|XP_008031225.1| hypothetical protein SETTUDRAFT_24691 [Setos... 90 7e-16 gb|EME38574.1| hypothetical protein DOTSEDRAFT_75929 [Dothistrom... 67 6e-09 gb|KJX96315.1| C2H2 finger domain protein [Zymoseptoria brevis] 60 7e-07 gb|KIW05110.1| hypothetical protein PV09_03666 [Verruconis gallo... 58 3e-06 >ref|XP_003835208.1| hypothetical protein LEMA_P045490.1 [Leptosphaeria maculans JN3] gi|312211759|emb|CBX91843.1| hypothetical protein LEMA_P045490.1 [Leptosphaeria maculans JN3] Length = 888 Score = 133 bits (335), Expect = 4e-29 Identities = 67/93 (72%), Positives = 73/93 (78%), Gaps = 5/93 (5%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGPNTPTRTTAPPL STS+Q+ + H KLNGQLKPLSVPDR HPS+DSP +WPPS Sbjct: 396 GGPNTPTRTTAPPL-STSSQDSASDPHAPLHKLNGQLKPLSVPDRRHPSIDSPGPKWPPS 454 Query: 86 GAISPGYSGFRSPVFDPGS-----TRFGSISTP 3 GAISPGY+GFRSPVFD S RFGSISTP Sbjct: 455 GAISPGYNGFRSPVFDASSLDSHRPRFGSISTP 487 >ref|XP_001795751.1| hypothetical protein SNOG_05345 [Phaeosphaeria nodorum SN15] gi|160706618|gb|EAT87736.2| hypothetical protein SNOG_05345 [Phaeosphaeria nodorum SN15] Length = 355 Score = 120 bits (302), Expect = 3e-25 Identities = 64/93 (68%), Positives = 71/93 (76%), Gaps = 5/93 (5%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGPNTPTR APPL S+SAQ+ + +H KLN LKPLSVPDRLHP+LDSP S+WPPS Sbjct: 32 GGPNTPTRANAPPL-SSSAQDS-SDAHPPLHKLNS-LKPLSVPDRLHPALDSPASKWPPS 88 Query: 86 GAISPGYSGFRSPVFDPGST-----RFGSISTP 3 GAISPGY GFRSP+FD S RFGSISTP Sbjct: 89 GAISPGYPGFRSPIFDSSSNDSHRGRFGSISTP 121 >gb|KKY27401.1| putative c2h2 finger domain [Diplodia seriata] Length = 398 Score = 105 bits (261), Expect = 2e-20 Identities = 55/95 (57%), Positives = 65/95 (68%), Gaps = 7/95 (7%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPP- 90 GGPNTP+R LSTSAQE T+ H + SKLNGQLKPLS+PDR S+D S WPP Sbjct: 33 GGPNTPSRGPGTGFLSTSAQETSTSPHNTLSKLNGQLKPLSMPDRRLSSVDLSASNWPPS 92 Query: 89 SGAISPGYSGFRSPVFDPGSTR------FGSISTP 3 SGAISPG +GFRSP++ PGS +GS+S P Sbjct: 93 SGAISPGQTGFRSPIYGPGSGENPAQRPYGSVSGP 127 >gb|EKG21305.1| Zinc finger C2H2-type protein [Macrophomina phaseolina MS6] Length = 677 Score = 105 bits (261), Expect = 2e-20 Identities = 55/95 (57%), Positives = 65/95 (68%), Gaps = 7/95 (7%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPP- 90 GGPNTP+R LSTSAQE T+ H + SKLNGQLKPLS+PDR S+D S WPP Sbjct: 183 GGPNTPSRGPGAGFLSTSAQETSTSPHNTLSKLNGQLKPLSMPDRRLSSVDLSASNWPPS 242 Query: 89 SGAISPGYSGFRSPVFDPGSTR------FGSISTP 3 SGAISPG +GFRSP++ PGS +GS+S P Sbjct: 243 SGAISPGQTGFRSPIYGPGSGENPAQRPYGSVSGP 277 >ref|XP_007582438.1| putative c2h2 finger domain protein [Neofusicoccum parvum UCRNP2] gi|485925566|gb|EOD50105.1| putative c2h2 finger domain protein [Neofusicoccum parvum UCRNP2] Length = 527 Score = 104 bits (259), Expect = 3e-20 Identities = 55/95 (57%), Positives = 65/95 (68%), Gaps = 7/95 (7%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPP- 90 GGPNTP+R LSTSAQE T+ H + SKLNGQLKPLS+PDR S+D S WPP Sbjct: 33 GGPNTPSRGPGSGFLSTSAQETSTSPHNTLSKLNGQLKPLSMPDRRLSSVDLSASGWPPS 92 Query: 89 SGAISPGYSGFRSPVFDPGSTR------FGSISTP 3 SGAISPG +GFRSP++ PGS +GS+S P Sbjct: 93 SGAISPGQTGFRSPIYGPGSGENPAPRPYGSVSGP 127 >ref|XP_007778088.1| hypothetical protein W97_01996 [Coniosporium apollinis CBS 100218] gi|494825617|gb|EON62771.1| hypothetical protein W97_01996 [Coniosporium apollinis CBS 100218] Length = 589 Score = 100 bits (250), Expect = 3e-19 Identities = 54/93 (58%), Positives = 62/93 (66%), Gaps = 6/93 (6%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGPNTPTR LSTSAQE T SH KLNGQLKPLS+P+R S+DSP +RWP S Sbjct: 146 GGPNTPTRIAGGNYLSTSAQETSTGSHNMVEKLNGQLKPLSMPERRFSSVDSPSTRWPSS 205 Query: 86 GAISPGYSGFRSPVF-----DPG-STRFGSIST 6 G +SPG GFRSP + DP S RF +IS+ Sbjct: 206 GTVSPGNMGFRSPGYEQTPTDPALSRRFSTISS 238 >ref|XP_001934653.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980532|gb|EDU47158.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 642 Score = 95.5 bits (236), Expect = 1e-17 Identities = 50/91 (54%), Positives = 59/91 (64%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGPNTPTRTTAPPL S S+Q+P T +H +KLNGQLKPL+VP Sbjct: 173 GGPNTPTRTTAPPLSSGSSQDPNTEAHAPINKLNGQLKPLTVP----------------- 215 Query: 86 GAISPGYSGFRSPVFDPGS---TRFGSISTP 3 A+SPGY+GFRSP+FDP R+ SISTP Sbjct: 216 -ALSPGYNGFRSPIFDPAEPHRARYNSISTP 245 >ref|XP_003296403.1| hypothetical protein PTT_06499 [Pyrenophora teres f. teres 0-1] gi|311331448|gb|EFQ95495.1| hypothetical protein PTT_06499 [Pyrenophora teres f. teres 0-1] Length = 612 Score = 94.0 bits (232), Expect = 4e-17 Identities = 49/91 (53%), Positives = 59/91 (64%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGPNTPTRTTAP L S+S+Q+P +H +KLNGQLKPL+VP Sbjct: 143 GGPNTPTRTTAPSLSSSSSQDPNAEAHAPINKLNGQLKPLTVP----------------- 185 Query: 86 GAISPGYSGFRSPVFDPGS---TRFGSISTP 3 A+SPGY+GFRSP+FDP R+GSISTP Sbjct: 186 -ALSPGYNGFRSPIFDPAEPHRARYGSISTP 215 >gb|EMD97765.1| hypothetical protein COCHEDRAFT_1221075 [Bipolaris maydis C5] gi|477585752|gb|ENI02839.1| hypothetical protein COCC4DRAFT_173998 [Bipolaris maydis ATCC 48331] Length = 643 Score = 92.4 bits (228), Expect = 1e-16 Identities = 49/91 (53%), Positives = 58/91 (63%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL ST+ Q+ T H+S K NGQLKPL+VP Sbjct: 174 GGPSTPTRTTAPPLSSTNTQDAATDPHSSIHKHNGQLKPLTVP----------------- 216 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 A+SPGY+GFRSP+FD P R+GSISTP Sbjct: 217 -ALSPGYTGFRSPIFDPTEPSRARYGSISTP 246 >ref|XP_007704329.1| hypothetical protein COCSADRAFT_248822 [Bipolaris sorokiniana ND90Pr] gi|451846801|gb|EMD60110.1| hypothetical protein COCSADRAFT_248822 [Bipolaris sorokiniana ND90Pr] Length = 643 Score = 91.3 bits (225), Expect = 2e-16 Identities = 48/91 (52%), Positives = 58/91 (63%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL S++ Q+ +T H S K NGQLKPL+VP Sbjct: 174 GGPSTPTRTTAPPLSSSNTQDAVTDPHISIYKHNGQLKPLTVP----------------- 216 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 A+SPGY+GFRSP+FD P R+GSISTP Sbjct: 217 -ALSPGYTGFRSPIFDPTEPSRVRYGSISTP 246 >gb|EUN21776.1| hypothetical protein COCVIDRAFT_113106 [Bipolaris victoriae FI3] Length = 643 Score = 90.9 bits (224), Expect = 3e-16 Identities = 48/91 (52%), Positives = 57/91 (62%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL S + Q+ + HTS K NGQLKPL+VP Sbjct: 174 GGPSTPTRTTAPPLSSGNTQDAVNDPHTSIHKPNGQLKPLTVP----------------- 216 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 A+SPGY+GFRSP+FD P R+GSISTP Sbjct: 217 -ALSPGYTGFRSPIFDPTEPSRARYGSISTP 246 >ref|XP_007714303.1| hypothetical protein COCCADRAFT_101408 [Bipolaris zeicola 26-R-13] gi|576917168|gb|EUC31400.1| hypothetical protein COCCADRAFT_101408 [Bipolaris zeicola 26-R-13] Length = 643 Score = 90.9 bits (224), Expect = 3e-16 Identities = 48/91 (52%), Positives = 57/91 (62%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL S + Q+ + HTS K NGQLKPL+VP Sbjct: 174 GGPSTPTRTTAPPLSSGNTQDAVNDPHTSIHKPNGQLKPLTVP----------------- 216 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 A+SPGY+GFRSP+FD P R+GSISTP Sbjct: 217 -ALSPGYTGFRSPIFDPTEPSRARYGSISTP 246 >ref|XP_007683394.1| hypothetical protein COCMIDRAFT_22427 [Bipolaris oryzae ATCC 44560] gi|576936611|gb|EUC50105.1| hypothetical protein COCMIDRAFT_22427 [Bipolaris oryzae ATCC 44560] Length = 612 Score = 90.5 bits (223), Expect = 4e-16 Identities = 48/91 (52%), Positives = 57/91 (62%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL S++ Q+ T H S K NGQLKPL+VP Sbjct: 143 GGPSTPTRTTAPPLSSSNTQDAATDPHASIHKHNGQLKPLTVP----------------- 185 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 A+SPGY+GFRSP+FD P R+GSISTP Sbjct: 186 -ALSPGYTGFRSPIFDPTEPSRARYGSISTP 215 >ref|XP_008031225.1| hypothetical protein SETTUDRAFT_24691 [Setosphaeria turcica Et28A] gi|482804064|gb|EOA81189.1| hypothetical protein SETTUDRAFT_24691 [Setosphaeria turcica Et28A] Length = 647 Score = 89.7 bits (221), Expect = 7e-16 Identities = 48/91 (52%), Positives = 57/91 (62%), Gaps = 3/91 (3%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSPISRWPPS 87 GGP+TPTRTTAPPL S++ Q+P +H + K N QLKPL+VP Sbjct: 177 GGPSTPTRTTAPPLSSSNPQDPTVDAHAAIHKHNAQLKPLTVP----------------- 219 Query: 86 GAISPGYSGFRSPVFD---PGSTRFGSISTP 3 AISPGYSGFRSP+FD P R+GSISTP Sbjct: 220 -AISPGYSGFRSPIFDSAEPPRARYGSISTP 249 >gb|EME38574.1| hypothetical protein DOTSEDRAFT_75929 [Dothistroma septosporum NZE10] Length = 670 Score = 66.6 bits (161), Expect = 6e-09 Identities = 45/98 (45%), Positives = 55/98 (56%), Gaps = 10/98 (10%) Frame = -1 Query: 266 GGP----NTPTRTT---APPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSP 108 GGP NTP RT+ APP S QE +H + NGQ +PLS+P+R LDSP Sbjct: 179 GGPSANLNTPKRTSLSYAPP----SVQETAQLAHAEAERRNGQPRPLSMPERQQTLLDSP 234 Query: 107 I-SRWPPSGAISPGYS--GFRSPVFDPGSTRFGSISTP 3 SRWP SGAISPG++ GF S P +R + TP Sbjct: 235 ASSRWPSSGAISPGFTAGGFWSEHSPPEFSRLHTSYTP 272 >gb|KJX96315.1| C2H2 finger domain protein [Zymoseptoria brevis] Length = 671 Score = 59.7 bits (143), Expect = 7e-07 Identities = 34/86 (39%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = -1 Query: 266 GGPNTPTRTTAPPLLSTSAQEPITTSHTSFSKLNGQLKPLSVPDRLHPSLDSP-ISRWPP 90 GGPN T S S QE +H + +GQL+PL++ DR + SP SRWP Sbjct: 187 GGPNGHTTPKRGSQTSVSMQETAQLAHAESERWSGQLRPLTMHDRRQSGMSSPGSSRWPS 246 Query: 89 SGAISPGYSGFRSPVFDPGSTRFGSI 12 SG +SPG+ GF V P ++R S+ Sbjct: 247 SGTLSPGFQGFFDHV-HPENSRNNSL 271 >gb|KIW05110.1| hypothetical protein PV09_03666 [Verruconis gallopava] Length = 672 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 8/69 (11%) Frame = -1 Query: 185 TSFSKLNGQLKPLSVPDRLHPSLDSPISRW--PPSGAISPGYSGFRSPVFDPGS------ 30 +S +K QLKPLSVP+ + S+DSP+SRW PS ISP GFRSP F+ S Sbjct: 189 SSNNKFAAQLKPLSVPEHRYSSIDSPLSRWASAPSSGISPS-GGFRSPYFEHTSIDSAFP 247 Query: 29 TRFGSISTP 3 +R S+STP Sbjct: 248 SRVNSVSTP 256