BLASTX nr result
ID: Anemarrhena21_contig00070124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00070124 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ENH81451.1| short chain oxidoreductase [Colletotrichum orbicu... 57 5e-06 gb|KDN61483.1| putative short chain dehydrogenase [Colletotrichu... 57 6e-06 ref|XP_007595840.1| short-chain dehydrogenase [Colletotrichum fi... 57 6e-06 gb|EKG11833.1| Short-chain dehydrogenase/reductase SDR [Macropho... 57 6e-06 ref|WP_013679263.1| 3-ketoacyl-ACP reductase [Thermoproteus uzon... 56 8e-06 >gb|ENH81451.1| short chain oxidoreductase [Colletotrichum orbiculare MAFF 240422] Length = 379 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -2 Query: 169 QRTHSSFLTIISPATPKPNMSLSGKVALITGASKGIGAATARELSSLGAKVVITY 5 +R+ S+ T P P PNMSLSGKVA++TG ++GIGAA A +L+ GA+V T+ Sbjct: 108 RRSSSNLWTKPLPQLPPPNMSLSGKVAIVTGGARGIGAAIALKLAREGARVAFTF 162 >gb|KDN61483.1| putative short chain dehydrogenase [Colletotrichum sublineola] Length = 362 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -2 Query: 169 QRTHSSFLTIISPATPKPNMSLSGKVALITGASKGIGAATARELSSLGAKVVITY 5 +R S+ T P P PNMSLSGKVA++TG ++GIGAA A +L+ GA+V T+ Sbjct: 91 RRASSALWTKPLPQLPPPNMSLSGKVAIVTGGARGIGAAIALKLAREGARVAFTF 145 >ref|XP_007595840.1| short-chain dehydrogenase [Colletotrichum fioriniae PJ7] gi|588899749|gb|EXF80503.1| short-chain dehydrogenase [Colletotrichum fioriniae PJ7] Length = 352 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -2 Query: 169 QRTHSSFLTIISPATPKPNMSLSGKVALITGASKGIGAATARELSSLGAKVVITY 5 +R S+ T P P PNMSLSGKVA++TG ++GIGAA A +L+ GA+V T+ Sbjct: 81 RRASSALWTKPLPQLPPPNMSLSGKVAIVTGGARGIGAAIALKLAREGARVAFTF 135 >gb|EKG11833.1| Short-chain dehydrogenase/reductase SDR [Macrophomina phaseolina MS6] Length = 266 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 127 TPKPNMSLSGKVALITGASKGIGAATARELSSLGAKVVITY 5 +P P +SL+GKVA++TG S+GIGAATA EL+ GAKV IT+ Sbjct: 4 SPSPPLSLAGKVAIVTGGSRGIGAATALELAKRGAKVAITF 44 >ref|WP_013679263.1| 3-ketoacyl-ACP reductase [Thermoproteus uzoniensis] gi|327310342|ref|YP_004337239.1| 3-ketoacyl-ACP reductase [Thermoproteus uzoniensis 768-20] gi|326946821|gb|AEA11927.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Thermoproteus uzoniensis 768-20] Length = 255 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 112 MSLSGKVALITGASKGIGAATARELSSLGAKVVITYS 2 MSLSGKVAL+TGAS+GIGAA AREL S GA+V I Y+ Sbjct: 1 MSLSGKVALVTGASRGIGAAIARELRSRGARVAINYN 37