BLASTX nr result
ID: Anemarrhena21_contig00069693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069693 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003841829.1| hypothetical protein LEMA_P097590.1 [Leptosp... 57 6e-06 >ref|XP_003841829.1| hypothetical protein LEMA_P097590.1 [Leptosphaeria maculans JN3] gi|312218404|emb|CBX98350.1| hypothetical protein LEMA_P097590.1 [Leptosphaeria maculans JN3] Length = 846 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 280 GTGGSTKSSAAATGLTVPQFQTGLLSLGLYVFGAVASGMAMI 155 G+G + S+ AA+GL+ P TG SLGLYVFGAVASGMAMI Sbjct: 803 GSGSGSNSTGAASGLSAPVLSTGAFSLGLYVFGAVASGMAMI 844