BLASTX nr result
ID: Anemarrhena21_contig00069593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069593 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJZ71240.1| hypothetical protein HIM_09383 [Hirsutella minnes... 62 1e-07 >gb|KJZ71240.1| hypothetical protein HIM_09383 [Hirsutella minnesotensis 3608] Length = 118 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -3 Query: 194 MKIFNLLPLILTLASAAPLAKPSNFEADPLLQVGSATESSYATKRGVFEADPMLQV-DSV 18 MK LL ++TLA+AAP FE++ L VG+ ESSYA KR FE+DP LQV D Sbjct: 2 MKSSLLLTALVTLAAAAPAPMAKYFESESALNVGNGQESSYAVKRAYFESDPQLQVGDGA 61 Query: 17 ESSYA 3 ESSYA Sbjct: 62 ESSYA 66