BLASTX nr result
ID: Anemarrhena21_contig00069464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069464 (250 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007360071.1| hypothetical protein DICSQDRAFT_94979 [Dicho... 58 3e-06 >ref|XP_007360071.1| hypothetical protein DICSQDRAFT_94979 [Dichomitus squalens LYAD-421 SS1] gi|395334144|gb|EJF66520.1| hypothetical protein DICSQDRAFT_94979 [Dichomitus squalens LYAD-421 SS1] Length = 215 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -2 Query: 99 CTRTYTVVEDDYCDLISANHNVSTYQLAVVNKD 1 CTRTYTV E D+CD ISA HNVSTYQLA VN D Sbjct: 24 CTRTYTVKEGDWCDTISAQHNVSTYQLAAVNPD 56