BLASTX nr result
ID: Anemarrhena21_contig00069293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069293 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007785951.1| hypothetical protein EPUS_02278 [Endocarpon ... 58 3e-06 ref|XP_001274841.1| conserved hypothetical protein [Aspergillus ... 58 3e-06 dbj|GAD96505.1| predicted protein [Byssochlamys spectabilis No. 5] 57 4e-06 ref|XP_007780579.1| hypothetical protein W97_04500 [Coniosporium... 57 4e-06 >ref|XP_007785951.1| hypothetical protein EPUS_02278 [Endocarpon pusillum Z07020] gi|539441508|gb|ERF76739.1| hypothetical protein EPUS_02278 [Endocarpon pusillum Z07020] Length = 527 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -2 Query: 269 CPTCNGGSSLSATERQTLAFLFGMGTITVLSFTWFANGFGIF 144 C TC+ ++LSA ERQ L F+ GM IT+LSFTWFA GFG+F Sbjct: 487 CATCS--AALSAHERQALGFVLGMSAITILSFTWFAGGFGVF 526 >ref|XP_001274841.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119402995|gb|EAW13415.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 297 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -2 Query: 269 CPTCNGGSSLSATERQTLAFLFGMGTITVLSFTWFANGFGIF 144 C TCNG +LS TERQ L F+FGM IT+ SFTWFA FG+F Sbjct: 256 CATCNG--ALSETERQALKFVFGMVFITIASFTWFAGDFGVF 295 >dbj|GAD96505.1| predicted protein [Byssochlamys spectabilis No. 5] Length = 288 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = -2 Query: 269 CPTCNGGSSLSATERQTLAFLFGMGTITVLSFTWFANGFGIF 144 C TC+G +LS ERQ L FLF M TITV SFTWFA GFG F Sbjct: 247 CVTCSG--ALSDMERQALGFLFTMATITVFSFTWFAGGFGFF 286 >ref|XP_007780579.1| hypothetical protein W97_04500 [Coniosporium apollinis CBS 100218] gi|494828450|gb|EON65262.1| hypothetical protein W97_04500 [Coniosporium apollinis CBS 100218] Length = 315 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 269 CPTCNGGSSLSATERQTLAFLFGMGTITVLSFTWFANGFGIF 144 C TC +S+ ERQ L + GMG ITVLSFTWFA GFG+F Sbjct: 274 CATCLKNGGISSIERQALTVIGGMGVITVLSFTWFAGGFGVF 315