BLASTX nr result
ID: Anemarrhena21_contig00069212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069212 (222 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO26058.1| hypothetical protein M407DRAFT_243864 [Tulasnella... 69 1e-09 ref|XP_001832361.1| RAN protein binding protein [Coprinopsis cin... 68 2e-09 gb|KIY70694.1| hypothetical protein CYLTODRAFT_441791 [Cylindrob... 68 3e-09 gb|KDQ31827.1| hypothetical protein PLEOSDRAFT_43137 [Pleurotus ... 68 3e-09 ref|XP_007393417.1| hypothetical protein PHACADRAFT_252096 [Phan... 68 3e-09 ref|XP_007384313.1| hypothetical protein PUNSTDRAFT_126434 [Punc... 68 3e-09 ref|XP_007301748.1| hypothetical protein STEHIDRAFT_137985 [Ster... 68 3e-09 gb|KIM70623.1| hypothetical protein SCLCIDRAFT_100715 [Scleroder... 67 3e-09 gb|KIK80479.1| hypothetical protein PAXRUDRAFT_833499 [Paxillus ... 67 6e-09 gb|KIJ15942.1| hypothetical protein PAXINDRAFT_168916 [Paxillus ... 67 6e-09 ref|XP_009550114.1| hypothetical protein HETIRDRAFT_479306 [Hete... 67 6e-09 gb|KJA23123.1| hypothetical protein HYPSUDRAFT_40269 [Hypholoma ... 66 8e-09 gb|KIJ38973.1| hypothetical protein M422DRAFT_33023 [Sphaerobolu... 66 8e-09 ref|XP_003027588.1| hypothetical protein SCHCODRAFT_83395 [Schiz... 66 8e-09 gb|KIY47528.1| hypothetical protein FISHEDRAFT_13956, partial [F... 66 1e-08 gb|KIO14264.1| hypothetical protein M404DRAFT_992525 [Pisolithus... 66 1e-08 ref|XP_012182551.1| predicted protein [Fibroporia radiculosa] gi... 66 1e-08 gb|EPT00609.1| hypothetical protein FOMPIDRAFT_1060333 [Fomitops... 65 1e-08 ref|XP_007004864.1| hypothetical protein TREMEDRAFT_73929 [Treme... 65 1e-08 gb|EKD02719.1| RAN protein binding protein [Trichosporon asahii ... 65 2e-08 >gb|KIO26058.1| hypothetical protein M407DRAFT_243864 [Tulasnella calospora MUT 4182] Length = 513 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPWKKFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 106 RDEPWKKFVQTFFLAEQPNGYFVLNDIFRFLK 137 >ref|XP_001832361.1| RAN protein binding protein [Coprinopsis cinerea okayama7#130] gi|116506500|gb|EAU89395.1| RAN protein binding protein [Coprinopsis cinerea okayama7#130] Length = 492 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R+EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 108 RNEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 139 >gb|KIY70694.1| hypothetical protein CYLTODRAFT_441791 [Cylindrobasidium torrendii FP15055 ss-10] Length = 455 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 107 RGEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 138 >gb|KDQ31827.1| hypothetical protein PLEOSDRAFT_43137 [Pleurotus ostreatus PC15] Length = 481 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 104 RGEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 135 >ref|XP_007393417.1| hypothetical protein PHACADRAFT_252096 [Phanerochaete carnosa HHB-10118-sp] gi|409048612|gb|EKM58090.1| hypothetical protein PHACADRAFT_252096 [Phanerochaete carnosa HHB-10118-sp] Length = 474 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 + EPWKKFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 99 KGEPWKKFVQTFFLAEQPNGYFVLNDIFRFLK 130 >ref|XP_007384313.1| hypothetical protein PUNSTDRAFT_126434 [Punctularia strigosozonata HHB-11173 SS5] gi|390598964|gb|EIN08361.1| hypothetical protein PUNSTDRAFT_126434 [Punctularia strigosozonata HHB-11173 SS5] Length = 478 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 + EPWKKFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 104 KGEPWKKFVQTFFLAEQPNGYFVLNDIFRFLK 135 >ref|XP_007301748.1| hypothetical protein STEHIDRAFT_137985 [Stereum hirsutum FP-91666 SS1] gi|389747608|gb|EIM88786.1| hypothetical protein STEHIDRAFT_137985 [Stereum hirsutum FP-91666 SS1] Length = 495 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 107 RGEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 138 >gb|KIM70623.1| hypothetical protein SCLCIDRAFT_100715 [Scleroderma citrinum Foug A] Length = 497 Score = 67.4 bits (163), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 216 SEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 S+PWKKFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 106 SDPWKKFVQTFFLAEQPNGYFVLNDIFRFLK 136 >gb|KIK80479.1| hypothetical protein PAXRUDRAFT_833499 [Paxillus rubicundulus Ve08.2h10] Length = 494 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R +PW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 103 RGDPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 134 >gb|KIJ15942.1| hypothetical protein PAXINDRAFT_168916 [Paxillus involutus ATCC 200175] Length = 495 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R +PW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 103 RGDPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 134 >ref|XP_009550114.1| hypothetical protein HETIRDRAFT_479306 [Heterobasidion irregulare TC 32-1] gi|575062496|gb|ETW78114.1| hypothetical protein HETIRDRAFT_479306 [Heterobasidion irregulare TC 32-1] Length = 553 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPW+KFVQTFFLAEQPNGY+VLNDIFR+LK Sbjct: 121 RGEPWRKFVQTFFLAEQPNGYYVLNDIFRFLK 152 >gb|KJA23123.1| hypothetical protein HYPSUDRAFT_40269 [Hypholoma sublateritium FD-334 SS-4] Length = 520 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 216 SEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 +EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 111 AEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 141 >gb|KIJ38973.1| hypothetical protein M422DRAFT_33023 [Sphaerobolus stellatus SS14] Length = 521 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 R EPW+KF QTFFLAEQPNGYFVLNDIFR+LK Sbjct: 113 RGEPWRKFAQTFFLAEQPNGYFVLNDIFRFLK 144 >ref|XP_003027588.1| hypothetical protein SCHCODRAFT_83395 [Schizophyllum commune H4-8] gi|300101275|gb|EFI92685.1| hypothetical protein SCHCODRAFT_83395 [Schizophyllum commune H4-8] Length = 472 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 + EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 107 QGEPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 138 >gb|KIY47528.1| hypothetical protein FISHEDRAFT_13956, partial [Fistulina hepatica ATCC 64428] Length = 474 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 213 EPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 108 EPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 137 >gb|KIO14264.1| hypothetical protein M404DRAFT_992525 [Pisolithus tinctorius Marx 270] Length = 488 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 213 EPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 +PWKKFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 107 DPWKKFVQTFFLAEQPNGYFVLNDIFRFLK 136 >ref|XP_012182551.1| predicted protein [Fibroporia radiculosa] gi|403416568|emb|CCM03268.1| predicted protein [Fibroporia radiculosa] Length = 490 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 213 EPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 EPW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 102 EPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 131 >gb|EPT00609.1| hypothetical protein FOMPIDRAFT_1060333 [Fomitopsis pinicola FP-58527 SS1] Length = 486 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 219 RSEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 + +PW+KFVQTFFLAEQPNGYFVLNDIFR+LK Sbjct: 101 KGDPWRKFVQTFFLAEQPNGYFVLNDIFRFLK 132 >ref|XP_007004864.1| hypothetical protein TREMEDRAFT_73929 [Tremella mesenterica DSM 1558] gi|392576510|gb|EIW69641.1| hypothetical protein TREMEDRAFT_73929 [Tremella mesenterica DSM 1558] Length = 563 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 210 PWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 PW+KFVQTFFLAEQPNGYFVLNDIFRYLK Sbjct: 126 PWRKFVQTFFLAEQPNGYFVLNDIFRYLK 154 >gb|EKD02719.1| RAN protein binding protein [Trichosporon asahii var. asahii CBS 8904] Length = 531 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 216 SEPWKKFVQTFFLAEQPNGYFVLNDIFRYLK 124 ++PW+KFVQTFFLAEQPNGY+VLNDIFRYLK Sbjct: 129 NKPWRKFVQTFFLAEQPNGYYVLNDIFRYLK 159