BLASTX nr result
ID: Anemarrhena21_contig00069162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069162 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001805850.1| hypothetical protein SNOG_15711 [Phaeosphaer... 98 2e-18 >ref|XP_001805850.1| hypothetical protein SNOG_15711 [Phaeosphaeria nodorum SN15] gi|160705555|gb|EAT76806.2| hypothetical protein SNOG_15711 [Phaeosphaeria nodorum SN15] Length = 653 Score = 98.2 bits (243), Expect = 2e-18 Identities = 41/80 (51%), Positives = 59/80 (73%), Gaps = 1/80 (1%) Frame = -2 Query: 239 DMGKLKDHLKRVHTRPRQCLNCWKDFSTEDARQDHLKEE-ACELQPQPKDERIRYEALLS 63 DM KLKDH+KRVHT+P +C CW + E+A DHL++E C+ +P+P+D+RIR + L Sbjct: 516 DMAKLKDHIKRVHTQPLRCSRCWMEMECEEAYSDHLQQENICDRRPEPQDDRIRPQLLKR 575 Query: 62 LNFNRVPYANLRNVADKWKL 3 L+F +VPY+N RNV +KW + Sbjct: 576 LDFKKVPYSNARNVEEKWSI 595