BLASTX nr result
ID: Anemarrhena21_contig00068992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068992 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003840918.1| similar to carbamoyl-phosphate synthase argi... 71 2e-10 ref|XP_001939745.1| carbamoyl-phosphate synthase arginine-specif... 69 2e-09 ref|XP_003298460.1| hypothetical protein PTT_09195 [Pyrenophora ... 66 8e-09 gb|EUN22286.1| glycoside hydrolase family 3 protein [Bipolaris v... 64 3e-08 ref|XP_007685354.1| glycoside hydrolase family 3 protein [Bipola... 64 3e-08 ref|XP_007709295.1| glycoside hydrolase family 3 protein [Bipola... 64 3e-08 ref|XP_008028859.1| glycoside hydrolase family 3 protein [Setosp... 64 3e-08 gb|ENI04649.1| glycoside hydrolase family 3 protein [Bipolaris m... 64 3e-08 gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolari... 64 3e-08 ref|XP_007700786.1| glycoside hydrolase family 3 protein [Bipola... 64 3e-08 gb|KIW02533.1| carbamoyl-phosphate synthase arginine-specific sm... 64 4e-08 ref|XP_001803201.1| hypothetical protein SNOG_12987 [Phaeosphaer... 63 7e-08 >ref|XP_003840918.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Leptosphaeria maculans JN3] gi|312217491|emb|CBX97439.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Leptosphaeria maculans JN3] Length = 506 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIE 213 FSDRNNKPSPLLVDLLSK RVGVHPA DF+GHA GK+E Sbjct: 444 FSDRNNKPSPLLVDLLSKVRVGVHPAQPDFEGHAPGKVE 482 >ref|XP_001939745.1| carbamoyl-phosphate synthase arginine-specific small chain [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975838|gb|EDU42464.1| carbamoyl-phosphate synthase arginine-specific small chain [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 444 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAG 222 FS+RNNKPSPLLVDLLSK+RVGVHPA DF+GHAAG Sbjct: 381 FSERNNKPSPLLVDLLSKQRVGVHPAAPDFEGHAAG 416 >ref|XP_003298460.1| hypothetical protein PTT_09195 [Pyrenophora teres f. teres 0-1] gi|311328327|gb|EFQ93452.1| hypothetical protein PTT_09195 [Pyrenophora teres f. teres 0-1] Length = 1255 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -2 Query: 326 SDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAG 222 S+RNNKPSPLLVDLLSK+RVGVHPA DF+GHAAG Sbjct: 1193 SERNNKPSPLLVDLLSKQRVGVHPAAPDFEGHAAG 1227 >gb|EUN22286.1| glycoside hydrolase family 3 protein [Bipolaris victoriae FI3] Length = 1244 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 1181 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 1224 >ref|XP_007685354.1| glycoside hydrolase family 3 protein [Bipolaris oryzae ATCC 44560] gi|576934642|gb|EUC48154.1| glycoside hydrolase family 3 protein [Bipolaris oryzae ATCC 44560] Length = 1244 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 1181 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 1224 >ref|XP_007709295.1| glycoside hydrolase family 3 protein [Bipolaris zeicola 26-R-13] gi|576922235|gb|EUC36365.1| glycoside hydrolase family 3 protein [Bipolaris zeicola 26-R-13] Length = 1244 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 1181 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 1224 >ref|XP_008028859.1| glycoside hydrolase family 3 protein [Setosphaeria turcica Et28A] gi|482806151|gb|EOA83224.1| glycoside hydrolase family 3 protein [Setosphaeria turcica Et28A] Length = 1255 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG ++ V Sbjct: 1192 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDTQQITV 1235 >gb|ENI04649.1| glycoside hydrolase family 3 protein [Bipolaris maydis ATCC 48331] Length = 1243 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 1180 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 1223 >gb|EMD92965.1| hypothetical protein COCHEDRAFT_1029204 [Bipolaris maydis C5] Length = 489 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 426 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 469 >ref|XP_007700786.1| glycoside hydrolase family 3 protein [Bipolaris sorokiniana ND90Pr] gi|451850466|gb|EMD63768.1| glycoside hydrolase family 3 protein [Bipolaris sorokiniana ND90Pr] Length = 1244 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEPEVIV 198 FS R+NKPSPLLVDLL+KERVGVHP DF+GHAAG +V V Sbjct: 1181 FSQRSNKPSPLLVDLLAKERVGVHPDAPDFEGHAAGMDSQQVNV 1224 >gb|KIW02533.1| carbamoyl-phosphate synthase arginine-specific small chain [Verruconis gallopava] Length = 473 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 323 DRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIEP 210 +R+NKPSPLLVDLLSKERVGVHP L D+ GHA G ++P Sbjct: 423 NRDNKPSPLLVDLLSKERVGVHPGLPDYQGHAPGMLDP 460 >ref|XP_001803201.1| hypothetical protein SNOG_12987 [Phaeosphaeria nodorum SN15] gi|121934833|sp|Q0U5H7.1|CARA_PHANO RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; Short=CPS-A; AltName: Full=Arginine-specific carbamoyl-phosphate synthetase, glutamine chain gi|111058667|gb|EAT79787.1| hypothetical protein SNOG_12987 [Phaeosphaeria nodorum SN15] Length = 476 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 329 FSDRNNKPSPLLVDLLSKERVGVHPALGDFDGHAAGKIE 213 FS+++NKPSPLLVDLLSKERVGVHPA DF+ H G++E Sbjct: 419 FSEKSNKPSPLLVDLLSKERVGVHPAQPDFEMHVPGRVE 457