BLASTX nr result
ID: Anemarrhena21_contig00068949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068949 (379 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001805819.1| hypothetical protein SNOG_15678 [Phaeosphaer... 58 3e-06 ref|XP_008021779.1| hypothetical protein SETTUDRAFT_101506 [Seto... 57 5e-06 >ref|XP_001805819.1| hypothetical protein SNOG_15678 [Phaeosphaeria nodorum SN15] gi|111055933|gb|EAT77053.1| hypothetical protein SNOG_15678 [Phaeosphaeria nodorum SN15] Length = 512 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 111 PPMASTEEPLRPIPAPTTAPGDPNGHHEITEPNFTVT 1 P M ST++ L PIP T PGDP+GHHEITEPNF+ T Sbjct: 151 PVMTSTDQGLHPIPPAATQPGDPDGHHEITEPNFSAT 187 >ref|XP_008021779.1| hypothetical protein SETTUDRAFT_101506 [Setosphaeria turcica Et28A] gi|482814473|gb|EOA91151.1| hypothetical protein SETTUDRAFT_101506 [Setosphaeria turcica Et28A] Length = 412 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -2 Query: 108 PMASTEEPLRPIPAPTTAPGDPNGHHEITEPNFTVT 1 PM ST + LRPIP T GDPNGHHEITEP+FT T Sbjct: 49 PMLSTNQGLRPIPPAATQIGDPNGHHEITEPDFTAT 84