BLASTX nr result
ID: Anemarrhena21_contig00068801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068801 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003840803.1| predicted protein [Leptosphaeria maculans JN... 57 6e-06 >ref|XP_003840803.1| predicted protein [Leptosphaeria maculans JN3] gi|312217376|emb|CBX97324.1| predicted protein [Leptosphaeria maculans JN3] Length = 646 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = -2 Query: 123 PSPIRLP--GRNIFSALAAMSYYNDPSW--PAPGRQASWEQPQPP 1 P P RL GR F+ MSYYN+PSW PAPGRQASWEQ QPP Sbjct: 213 PQPRRLLSLGRRSFALGITMSYYNEPSWSAPAPGRQASWEQSQPP 257