BLASTX nr result
ID: Anemarrhena21_contig00068607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068607 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63121.1| hypothetical protein 18.t00017 [Asparagus officin... 59 2e-06 >gb|ABD63121.1| hypothetical protein 18.t00017 [Asparagus officinalis] Length = 489 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -1 Query: 177 TWEEFLYRFDLQYISSAIKAAKEMELMNLEQADMTIAAYES*FTILC*FTN 25 +WE+F+Y FD QYISS + K++EL LEQ DMT+A YES F L FT+ Sbjct: 162 SWEDFVYFFDEQYISSVAQVEKKLELTKLEQGDMTVAEYESRFMSLLHFTS 212