BLASTX nr result
ID: Anemarrhena21_contig00068369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068369 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007784437.1| hypothetical protein W97_08306 [Coniosporium... 61 3e-07 >ref|XP_007784437.1| hypothetical protein W97_08306 [Coniosporium apollinis CBS 100218] gi|494833042|gb|EON69120.1| hypothetical protein W97_08306 [Coniosporium apollinis CBS 100218] Length = 534 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/59 (52%), Positives = 36/59 (61%) Frame = -3 Query: 179 LKTKDPNDHSGEPMKLHDGPAEKVASTQAERRESKVGNPGGQEHGKDEPKGTGEEWVKT 3 L +DP+DHSGEPMK+H G E R +G PGG EHGK GTGE+WVKT Sbjct: 416 LNKRDPDDHSGEPMKVHGGSEE-----DEPDRSKSMGQPGGGEHGK--VYGTGEKWVKT 467