BLASTX nr result
ID: Anemarrhena21_contig00068362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00068362 (608 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU37841.1| hypothetical protein AG1IA_08127 [Rhizoctonia sol... 56 3e-09 >gb|ELU37841.1| hypothetical protein AG1IA_08127 [Rhizoctonia solani AG-1 IA] Length = 139 Score = 55.8 bits (133), Expect(2) = 3e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 6 DYRFKQHTSLRLLQN*LIFLFSLLQVYS*GGMVN 107 DYR KQH SLRLL+ LIFLFSLLQVYS GGMVN Sbjct: 15 DYRIKQHASLRLLRGRLIFLFSLLQVYSQGGMVN 48 Score = 32.3 bits (72), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +2 Query: 173 VLEYLILFPAYTFVPQRQS 229 VL YLILFPA TFV QRQS Sbjct: 55 VLGYLILFPAPTFVSQRQS 73