BLASTX nr result
ID: Anemarrhena21_contig00067914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067914 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012469583.1| PREDICTED: microtubule-associated protein RP... 114 3e-23 gb|KHG04118.1| Microtubule-associated protein RP/EB family membe... 114 3e-23 ref|XP_007047391.1| End binding protein 1C isoform 2 [Theobroma ... 114 3e-23 ref|XP_007047390.1| End binding protein 1C isoform 1 [Theobroma ... 114 3e-23 ref|XP_010095316.1| Microtubule-associated protein RP/EB family ... 114 3e-23 ref|XP_010688547.1| PREDICTED: microtubule-associated protein RP... 112 7e-23 gb|KGN48555.1| hypothetical protein Csa_6G491670 [Cucumis sativus] 112 7e-23 ref|XP_008440321.1| PREDICTED: microtubule-associated protein RP... 112 7e-23 ref|XP_006844015.1| PREDICTED: microtubule-associated protein RP... 112 7e-23 ref|XP_004141898.1| PREDICTED: microtubule-associated protein RP... 112 7e-23 ref|XP_012853708.1| PREDICTED: microtubule-associated protein RP... 112 1e-22 ref|XP_006466548.1| PREDICTED: microtubule-associated protein RP... 111 2e-22 ref|XP_009367605.1| PREDICTED: microtubule-associated protein RP... 111 2e-22 ref|XP_002524922.1| microtubule binding protein, putative [Ricin... 111 2e-22 ref|XP_006425983.1| hypothetical protein CICLE_v10026070mg [Citr... 110 4e-22 ref|XP_011099093.1| PREDICTED: microtubule-associated protein RP... 110 5e-22 ref|XP_009400287.1| PREDICTED: microtubule-associated protein RP... 110 5e-22 ref|XP_009350531.1| PREDICTED: microtubule-associated protein RP... 109 8e-22 ref|XP_009372442.1| PREDICTED: microtubule-associated protein RP... 109 8e-22 ref|XP_002990863.1| hypothetical protein SELMODRAFT_185601 [Sela... 109 8e-22 >ref|XP_012469583.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Gossypium raimondii] gi|763750588|gb|KJB17976.1| hypothetical protein B456_003G027200 [Gossypium raimondii] Length = 329 Score = 114 bits (285), Expect = 3e-23 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR+EILAWIN+TLHLNLSKVEEA SGAVHCQL+D+VHPGMVP+HK Sbjct: 2 ATNIGMMDGAYFVGRSEILAWINTTLHLNLSKVEEACSGAVHCQLMDSVHPGMVPMHK 59 >gb|KHG04118.1| Microtubule-associated protein RP/EB family member 3 [Gossypium arboreum] gi|728834705|gb|KHG14148.1| Microtubule-associated protein RP/EB family member 3 [Gossypium arboreum] gi|728837279|gb|KHG16722.1| Microtubule-associated protein RP/EB family member 3 [Gossypium arboreum] Length = 329 Score = 114 bits (285), Expect = 3e-23 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR+EILAWIN+TLHLNLSKVEEA SGAVHCQL+D+VHPGMVP+HK Sbjct: 2 ATNIGMMDGAYFVGRSEILAWINTTLHLNLSKVEEACSGAVHCQLMDSVHPGMVPMHK 59 >ref|XP_007047391.1| End binding protein 1C isoform 2 [Theobroma cacao] gi|508699652|gb|EOX91548.1| End binding protein 1C isoform 2 [Theobroma cacao] Length = 241 Score = 114 bits (285), Expect = 3e-23 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA SGAVHCQL+DAVHPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACSGAVHCQLMDAVHPGMVPMHK 59 >ref|XP_007047390.1| End binding protein 1C isoform 1 [Theobroma cacao] gi|508699651|gb|EOX91547.1| End binding protein 1C isoform 1 [Theobroma cacao] Length = 327 Score = 114 bits (285), Expect = 3e-23 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA SGAVHCQL+DAVHPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACSGAVHCQLMDAVHPGMVPMHK 59 >ref|XP_010095316.1| Microtubule-associated protein RP/EB family member 3 [Morus notabilis] gi|587870237|gb|EXB59527.1| Microtubule-associated protein RP/EB family member 3 [Morus notabilis] Length = 328 Score = 114 bits (284), Expect = 3e-23 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR+EILAWINSTLHLNLSKVE+A SGAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDGAYFVGRSEILAWINSTLHLNLSKVEDACSGAVHCQLMDAAHPGMVPMHK 59 >ref|XP_010688547.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Beta vulgaris subsp. vulgaris] gi|870868310|gb|KMT19162.1| hypothetical protein BVRB_1g015560 [Beta vulgaris subsp. vulgaris] Length = 322 Score = 112 bits (281), Expect = 7e-23 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 A+NIGMMD AYFVGR+EIL+WINSTLHLNLSKVEEAASGAVHCQL+DA HPGMVPIHK Sbjct: 2 ASNIGMMDSAYFVGRSEILSWINSTLHLNLSKVEEAASGAVHCQLMDAAHPGMVPIHK 59 >gb|KGN48555.1| hypothetical protein Csa_6G491670 [Cucumis sativus] Length = 314 Score = 112 bits (281), Expect = 7e-23 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA SGAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACSGAVHCQLMDAAHPGMVPMHK 59 >ref|XP_008440321.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Cucumis melo] Length = 329 Score = 112 bits (281), Expect = 7e-23 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA SGAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACSGAVHCQLMDAAHPGMVPMHK 59 >ref|XP_006844015.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Amborella trichopoda] gi|548846414|gb|ERN05690.1| hypothetical protein AMTR_s00006p00208070 [Amborella trichopoda] Length = 335 Score = 112 bits (281), Expect = 7e-23 Identities = 54/60 (90%), Positives = 56/60 (93%) Frame = -1 Query: 180 MAATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 MAATNIGMMD AYFVGR EILAWINSTL LNLSKVEEAASGAV CQL+DAVHPGMVP+HK Sbjct: 1 MAATNIGMMDAAYFVGRTEILAWINSTLQLNLSKVEEAASGAVQCQLMDAVHPGMVPMHK 60 >ref|XP_004141898.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Cucumis sativus] Length = 329 Score = 112 bits (281), Expect = 7e-23 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA SGAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACSGAVHCQLMDAAHPGMVPMHK 59 >ref|XP_012853708.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Erythranthe guttatus] gi|604345944|gb|EYU44441.1| hypothetical protein MIMGU_mgv1a009620mg [Erythranthe guttata] Length = 336 Score = 112 bits (280), Expect = 1e-22 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR+EILAWINSTLHLNLSKVEEA +GAV CQL+DAVHPGMVP+HK Sbjct: 2 ATNIGMMDGAYFVGRSEILAWINSTLHLNLSKVEEACTGAVQCQLMDAVHPGMVPMHK 59 >ref|XP_006466548.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Citrus sinensis] Length = 326 Score = 111 bits (278), Expect = 2e-22 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA +GAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACTGAVHCQLMDATHPGMVPMHK 59 >ref|XP_009367605.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Pyrus x bretschneideri] Length = 338 Score = 111 bits (277), Expect = 2e-22 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR EILAWINSTLHLNLSKVEEA SGAVHCQL+DAVH G+VP+HK Sbjct: 2 ATNIGMMDGAYFVGRTEILAWINSTLHLNLSKVEEACSGAVHCQLMDAVHNGIVPMHK 59 >ref|XP_002524922.1| microtubule binding protein, putative [Ricinus communis] gi|223535757|gb|EEF37419.1| microtubule binding protein, putative [Ricinus communis] Length = 264 Score = 111 bits (277), Expect = 2e-22 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTL LNLSKVEEA SGAVHCQL+DAVHPGMVP+HK Sbjct: 2 ATNIGMMDAAYFVGRSEILAWINSTLQLNLSKVEEACSGAVHCQLMDAVHPGMVPMHK 59 >ref|XP_006425983.1| hypothetical protein CICLE_v10026070mg [Citrus clementina] gi|557527973|gb|ESR39223.1| hypothetical protein CICLE_v10026070mg [Citrus clementina] Length = 326 Score = 110 bits (275), Expect = 4e-22 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNL+KVEEA +GAVHCQL+DA HPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLAKVEEACTGAVHCQLMDATHPGMVPMHK 59 >ref|XP_011099093.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Sesamum indicum] gi|747101899|ref|XP_011099094.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Sesamum indicum] Length = 336 Score = 110 bits (274), Expect = 5e-22 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGR+EILAWINSTLHLNLSKVEEA +GAV CQL+DAVHPGMVP+HK Sbjct: 2 ATNIGMMDSAYFVGRSEILAWINSTLHLNLSKVEEACTGAVQCQLMDAVHPGMVPMHK 59 >ref|XP_009400287.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Musa acuminata subsp. malaccensis] Length = 326 Score = 110 bits (274), Expect = 5e-22 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMD AYFVGRNEILAWINSTL LNLSKVEEA SGAVHCQL+DA HPG+VP+HK Sbjct: 2 ATNIGMMDSAYFVGRNEILAWINSTLQLNLSKVEEACSGAVHCQLMDAAHPGIVPMHK 59 >ref|XP_009350531.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Pyrus x bretschneideri] Length = 331 Score = 109 bits (272), Expect = 8e-22 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR EILAWINSTLHL+LSKVEEA SGAVHCQL+DAVH G+VP+HK Sbjct: 2 ATNIGMMDGAYFVGRTEILAWINSTLHLHLSKVEEACSGAVHCQLMDAVHNGIVPMHK 59 >ref|XP_009372442.1| PREDICTED: microtubule-associated protein RP/EB family member 1C-like [Pyrus x bretschneideri] Length = 331 Score = 109 bits (272), Expect = 8e-22 Identities = 51/58 (87%), Positives = 55/58 (94%) Frame = -1 Query: 174 ATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 ATNIGMMDGAYFVGR EILAWINSTLHL+LSKVEEA SGAVHCQL+DAVH G+VP+HK Sbjct: 2 ATNIGMMDGAYFVGRTEILAWINSTLHLHLSKVEEACSGAVHCQLMDAVHNGIVPMHK 59 >ref|XP_002990863.1| hypothetical protein SELMODRAFT_185601 [Selaginella moellendorffii] gi|300141424|gb|EFJ08136.1| hypothetical protein SELMODRAFT_185601 [Selaginella moellendorffii] Length = 315 Score = 109 bits (272), Expect = 8e-22 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = -1 Query: 180 MAATNIGMMDGAYFVGRNEILAWINSTLHLNLSKVEEAASGAVHCQLLDAVHPGMVPIHK 1 MAA NIGMMD AYFVGRNE+LAW+NS L LNLS+VEEAASGAVHCQL+D+VHPG+VP+HK Sbjct: 1 MAAANIGMMDSAYFVGRNELLAWVNSVLQLNLSRVEEAASGAVHCQLIDSVHPGVVPMHK 60