BLASTX nr result
ID: Anemarrhena21_contig00067184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067184 (207 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIM19405.1| hypothetical protein M408DRAFT_231258 [Serendipit... 60 4e-07 >gb|KIM19405.1| hypothetical protein M408DRAFT_231258 [Serendipita vermifera MAFF 305830] Length = 78 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 121 VGQRQFRAREKGRRNVAVFGLCYSLLLYVSVGTEDRSAP 5 +GQ QFR REK NVAVFG CYSL+LYV VGTE+RSAP Sbjct: 1 MGQHQFRPREKDTWNVAVFGQCYSLVLYVLVGTEERSAP 39