BLASTX nr result
ID: Anemarrhena21_contig00067175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067175 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIS36590.1| hypothetical protein NTHI1209_00002 [Haemophilus ... 63 9e-08 >gb|KIS36590.1| hypothetical protein NTHI1209_00002 [Haemophilus influenzae] Length = 85 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/54 (61%), Positives = 36/54 (66%) Frame = +2 Query: 5 VCNGLVSRHDPRLQTVLYPPE*YLRHYLNSFRREPAISRFV*PFTPIHSSSTHY 166 VC GLVSR P +TVLYP R YLN FR EPAISRF PFTP H SS ++ Sbjct: 12 VCIGLVSRDGPLAETVLYPKGVTSRLYLNRFRGEPAISRFDWPFTPSHKSSANF 65