BLASTX nr result
ID: Anemarrhena21_contig00067171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067171 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007693691.1| hypothetical protein COCMIDRAFT_10188 [Bipol... 79 2e-12 ref|XP_007699129.1| hypothetical protein COCSADRAFT_36243 [Bipol... 79 2e-12 ref|XP_007715131.1| hypothetical protein COCCADRAFT_7427 [Bipola... 78 2e-12 gb|EMD88091.1| hypothetical protein COCHEDRAFT_1023318 [Bipolari... 77 3e-12 gb|EUN29499.1| hypothetical protein COCVIDRAFT_92881 [Bipolaris ... 76 8e-12 ref|XP_001941509.1| conserved hypothetical protein [Pyrenophora ... 75 1e-11 ref|XP_001802836.1| hypothetical protein SNOG_12615 [Phaeosphaer... 75 2e-11 ref|XP_003298765.1| hypothetical protein PTT_09570 [Pyrenophora ... 74 5e-11 ref|XP_003834332.1| similar to 50S ribosomal protein L4 [Leptosp... 65 1e-08 ref|XP_008028093.1| hypothetical protein SETTUDRAFT_32981 [Setos... 64 5e-08 >ref|XP_007693691.1| hypothetical protein COCMIDRAFT_10188 [Bipolaris oryzae ATCC 44560] gi|576925968|gb|EUC39788.1| hypothetical protein COCMIDRAFT_10188 [Bipolaris oryzae ATCC 44560] Length = 255 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN+ RD+TVQETMKAILDTL ER A++EA+ALA +DP IDL++TDG Q YD E Sbjct: 170 ENQERDKTVQETMKAILDTLAERHQAYQEAYALAQRDPDIDLSRTDGPQYTQPPYDPLEA 229 Query: 183 DD 178 DD Sbjct: 230 DD 231 >ref|XP_007699129.1| hypothetical protein COCSADRAFT_36243 [Bipolaris sorokiniana ND90Pr] gi|451851578|gb|EMD64876.1| hypothetical protein COCSADRAFT_36243 [Bipolaris sorokiniana ND90Pr] Length = 255 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN+ RD+TVQETMKAILDTL ER A++EA+ALA +DP IDL++TDG Q YD E Sbjct: 170 ENQERDKTVQETMKAILDTLAERHQAYQEAYALAQRDPDIDLSRTDGPQYTQPPYDPLEA 229 Query: 183 DD 178 DD Sbjct: 230 DD 231 >ref|XP_007715131.1| hypothetical protein COCCADRAFT_7427 [Bipolaris zeicola 26-R-13] gi|576916303|gb|EUC30567.1| hypothetical protein COCCADRAFT_7427 [Bipolaris zeicola 26-R-13] Length = 255 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/62 (62%), Positives = 47/62 (75%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN+ RD+TVQETMKAILDTL ER A++EA+ALA +DP IDL++TDG Q YD E Sbjct: 170 ENQGRDKTVQETMKAILDTLAERHQAYQEAYALAQRDPDIDLSRTDGPQYTQPPYDPLEA 229 Query: 183 DD 178 DD Sbjct: 230 DD 231 >gb|EMD88091.1| hypothetical protein COCHEDRAFT_1023318 [Bipolaris maydis C5] gi|477585236|gb|ENI02325.1| hypothetical protein COCC4DRAFT_33596 [Bipolaris maydis ATCC 48331] Length = 255 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN RD+TVQETMKAILDTL ER A++EA+ALA +DP IDL++TDG Q YD E Sbjct: 170 ENHGRDKTVQETMKAILDTLAERHQAYQEAYALAQRDPDIDLSRTDGPQYTQPPYDPLEA 229 Query: 183 DD 178 DD Sbjct: 230 DD 231 >gb|EUN29499.1| hypothetical protein COCVIDRAFT_92881 [Bipolaris victoriae FI3] Length = 255 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN+ RD+TVQETMKAILDTL ER A++EA+ALA +DP IDL++ DG Q YD E Sbjct: 170 ENQGRDKTVQETMKAILDTLAERHQAYQEAYALAQRDPDIDLSRADGPQYTQPPYDPLEA 229 Query: 183 DD 178 DD Sbjct: 230 DD 231 >ref|XP_001941509.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977602|gb|EDU44228.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 264 Score = 75.5 bits (184), Expect = 1e-11 Identities = 46/92 (50%), Positives = 52/92 (56%), Gaps = 5/92 (5%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN RD+TVQETMKAILDTL ER A++EA ALA DP IDL KTDG Q YD E Sbjct: 171 ENANRDQTVQETMKAILDTLAERHKAYQEAFALAQNDPEIDLQKTDGPQYTQVPYDPLEE 230 Query: 183 DD-----PQGTIMKQGEERIEGKELPEKSFFN 103 D+ Q I++ G I E K N Sbjct: 231 DEAAQDAQQEAIVESGPNDITSAEARPKDKTN 262 >ref|XP_001802836.1| hypothetical protein SNOG_12615 [Phaeosphaeria nodorum SN15] gi|229891770|sp|Q0U6J9.2|RM04_PHANO RecName: Full=54S ribosomal protein L4, mitochondrial; Flags: Precursor gi|160703690|gb|EAT79913.2| hypothetical protein SNOG_12615 [Phaeosphaeria nodorum SN15] Length = 250 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/57 (66%), Positives = 44/57 (77%) Frame = -1 Query: 366 EENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYD 196 +ENK RD VQETMKAILDTL+ER A+ EA LA QDPSIDL++TDG Q V AY+ Sbjct: 161 QENKDRDTVVQETMKAILDTLSERHQAYMEAVELAKQDPSIDLSRTDGPQFVEPAYE 217 >ref|XP_003298765.1| hypothetical protein PTT_09570 [Pyrenophora teres f. teres 0-1] gi|311327901|gb|EFQ93152.1| hypothetical protein PTT_09570 [Pyrenophora teres f. teres 0-1] Length = 265 Score = 73.6 bits (179), Expect = 5e-11 Identities = 45/92 (48%), Positives = 53/92 (57%), Gaps = 5/92 (5%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 E+ RD+TVQETMKAILDTL ER A++EA ALA +DP IDL KTDG Q YD E Sbjct: 172 ESANRDKTVQETMKAILDTLAERHQAYQEAFALAQKDPGIDLQKTDGPQYTQVPYDPLEE 231 Query: 183 DD-----PQGTIMKQGEERIEGKELPEKSFFN 103 D+ Q I++ G I E K N Sbjct: 232 DEAAQDAQQEAIVESGPNDITSAEARPKDKAN 263 >ref|XP_003834332.1| similar to 50S ribosomal protein L4 [Leptosphaeria maculans JN3] gi|312210881|emb|CBX90967.1| similar to 50S ribosomal protein L4 [Leptosphaeria maculans JN3] Length = 252 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/63 (58%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDA-YDTEE 187 ENK RD VQETMKAILDTL ER A+ +A LA +DPSI+L K +G Q + A YD E Sbjct: 171 ENKQRDTVVQETMKAILDTLAERHQAYTDALELAKRDPSINLRKRNGPQYIQPAPYDLFE 230 Query: 186 LDD 178 DD Sbjct: 231 ADD 233 >ref|XP_008028093.1| hypothetical protein SETTUDRAFT_32981 [Setosphaeria turcica Et28A] gi|482806919|gb|EOA83971.1| hypothetical protein SETTUDRAFT_32981 [Setosphaeria turcica Et28A] Length = 266 Score = 63.5 bits (153), Expect = 5e-08 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = -1 Query: 363 ENKIRDETVQETMKAILDTLNERQNAWEEAHALATQDPSIDLTKTDGAQLVVDAYDTEEL 184 EN+ RD+TVQETM+AILD+L ER+ A+ EA LA DP ID +KT + YD E Sbjct: 176 ENQERDKTVQETMQAILDSLAERRQAYREALVLAQNDPDIDFSKTGLPRYTTPPYDPLEA 235 Query: 183 DD 178 DD Sbjct: 236 DD 237