BLASTX nr result
ID: Anemarrhena21_contig00066752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00066752 (1031 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU37844.1| hypothetical protein AG1IA_08121 [Rhizoctonia sol... 85 1e-13 ref|YP_007374883.1| hypothetical protein Pra_mt0305 (mitochondri... 67 2e-08 >gb|ELU37844.1| hypothetical protein AG1IA_08121 [Rhizoctonia solani AG-1 IA] Length = 67 Score = 84.7 bits (208), Expect = 1e-13 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 779 MFRGKPAITR*DWPFTPFHSSSENYATFTRSIHYNLAMERSPCFGSNKIN 928 MFRG AI+R +WPFTPFHSSSEN+ATF RSIHYNLAMERSP FGSN N Sbjct: 1 MFRGISAISRSEWPFTPFHSSSENFATFIRSIHYNLAMERSPRFGSNISN 50 >ref|YP_007374883.1| hypothetical protein Pra_mt0305 (mitochondrion) (mitochondrion) [Phlebia radiata] gi|441414400|emb|CCF07373.1| hypothetical protein Pra_mt0305 (mitochondrion) (mitochondrion) [Phlebia radiata] Length = 57 Score = 67.4 bits (163), Expect = 2e-08 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = -2 Query: 877 MDRTGECCIILR*AVERGERPILPCDSWFSTKHMLV*VLSKI*EGT 740 MDRTGECCIILR + GERPI P DSWFSTKHM+V L KI GT Sbjct: 1 MDRTGECCIILRWVLRSGERPIWPSDSWFSTKHMIVWHLYKIYGGT 46