BLASTX nr result
ID: Anemarrhena21_contig00066310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00066310 (298 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001795164.1| hypothetical protein SNOG_04752 [Phaeosphaer... 64 3e-08 ref|XP_001938123.1| conserved hypothetical protein [Pyrenophora ... 62 2e-07 ref|XP_003298506.1| hypothetical protein PTT_09254 [Pyrenophora ... 57 5e-06 >ref|XP_001795164.1| hypothetical protein SNOG_04752 [Phaeosphaeria nodorum SN15] gi|111067392|gb|EAT88512.1| hypothetical protein SNOG_04752 [Phaeosphaeria nodorum SN15] Length = 353 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -2 Query: 186 SPYYMDYYFCSAEELRQELSRRGYFPVGGQDELSEELKQDDTTRGTDATTIKTVDSAHFG 7 SP M YY CS E L E+ RRGY +G +D+LSE L+ DD RG+DATT+ T S F Sbjct: 83 SPRRMIYYQCSTEALNLEIRRRGYIFIGCRDQLSEALQTDDNVRGSDATTVTTEVSGPFV 142 Query: 6 PK 1 P+ Sbjct: 143 PR 144 >ref|XP_001938123.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985222|gb|EDU50710.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 281 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -2 Query: 174 MDYYFCSAEELRQELSRRGY-FPVGGQDELSEELKQDDTTRGTDATTIKTVDSAHFGPK 1 M YY CSA+ L QE RRG+ +DEL+E LKQDD TRG+DATT+ TV F PK Sbjct: 1 MSYYQCSAQSLSQETDRRGFDTDQCTKDELAEYLKQDDETRGSDATTVGTVKPGEFIPK 59 >ref|XP_003298506.1| hypothetical protein PTT_09254 [Pyrenophora teres f. teres 0-1] gi|311328232|gb|EFQ93383.1| hypothetical protein PTT_09254 [Pyrenophora teres f. teres 0-1] Length = 280 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -2 Query: 174 MDYYFCSAEELRQELSRRGY-FPVGGQDELSEELKQDDTTRGTDATTIKT 28 M YY CSA+ LRQE RRG+ +DEL+E LKQDD RG+DATT++T Sbjct: 1 MSYYRCSADNLRQETDRRGFNTDHSTKDELAEYLKQDDEARGSDATTMET 50