BLASTX nr result
ID: Anemarrhena21_contig00066275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00066275 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008084828.1| Cytochrome P450 [Glarea lozoyensis ATCC 2086... 74 3e-11 >ref|XP_008084828.1| Cytochrome P450 [Glarea lozoyensis ATCC 20868] gi|512198635|gb|EPE27469.1| Cytochrome P450 [Glarea lozoyensis ATCC 20868] Length = 338 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/62 (61%), Positives = 47/62 (75%) Frame = -1 Query: 189 IQNPVKERIAGRGTPVEILDSFIARGLHESDAVGDLLIILSAGIDTTAMATEALLYFVLS 10 IQN V+ER A RG VE+LD FIARGL E DA+ +LLII+SAGI+TT A EA+L+ +L Sbjct: 116 IQNVVRERFAKRGPKVEMLDMFIARGLTEKDAMEELLIIMSAGIETTTTAFEAILFLMLQ 175 Query: 9 NP 4 P Sbjct: 176 TP 177