BLASTX nr result
ID: Anemarrhena21_contig00066059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00066059 (263 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003297700.1| hypothetical protein PTT_08192 [Pyrenophora ... 63 9e-08 ref|XP_007580615.1| putative nitrate reductase protein [Neofusic... 62 2e-07 ref|XP_001796410.1| hypothetical protein SNOG_06022 [Phaeosphaer... 62 2e-07 emb|CAA74005.1| nitrate reductase (NADPH) [Parastagonospora nodo... 62 2e-07 gb|EKG14125.1| hypothetical protein MPH_08704 [Macrophomina phas... 61 3e-07 gb|KKY23157.1| putative nitrate reductase [Diplodia seriata] 60 8e-07 ref|XP_007831791.1| Nitrate reductase [NADPH] [Pestalotiopsis fi... 59 2e-06 ref|XP_007289633.1| nitrate reductase [Marssonina brunnea f. sp.... 58 2e-06 ref|XP_008087137.1| Oxidoreductase molybdopterin-binding protein... 57 6e-06 gb|KIW08956.1| hypothetical protein PV09_00868 [Verruconis gallo... 56 8e-06 gb|EMR91014.1| putative nitrate reductase protein [Botrytis cine... 56 8e-06 gb|EMF15198.1| nitrate reductase [NADPH] [Sphaerulina musiva SO2... 56 8e-06 emb|CCD46109.1| NiaD, nitrate reductase [Botrytis cinerea T4] 56 8e-06 ref|XP_003849160.1| hypothetical protein MYCGRDRAFT_111003 [Zymo... 56 8e-06 ref|XP_001551502.1| hypothetical protein BC1G_09772 [Botrytis ci... 56 8e-06 >ref|XP_003297700.1| hypothetical protein PTT_08192 [Pyrenophora teres f. teres 0-1] gi|311329470|gb|EFQ94196.1| hypothetical protein PTT_08192 [Pyrenophora teres f. teres 0-1] Length = 891 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GESLVLICGPEALEK+AHK L LGW DEDL+FF Sbjct: 858 GESLVLICGPEALEKAAHKALGELGWKDEDLMFF 891 >ref|XP_007580615.1| putative nitrate reductase protein [Neofusicoccum parvum UCRNP2] gi|485928113|gb|EOD51911.1| putative nitrate reductase protein [Neofusicoccum parvum UCRNP2] Length = 849 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 9 ESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 E+LVL+CGPEALEKSAHK LN +GW DEDLLFF Sbjct: 817 ETLVLLCGPEALEKSAHKALNEMGWKDEDLLFF 849 >ref|XP_001796410.1| hypothetical protein SNOG_06022 [Phaeosphaeria nodorum SN15] gi|160706885|gb|EAT87086.2| hypothetical protein SNOG_06022 [Phaeosphaeria nodorum SN15] Length = 697 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 G SLVLICGPEALEKS HK LN +GW DEDL+FF Sbjct: 664 GSSLVLICGPEALEKSTHKALNEMGWRDEDLMFF 697 >emb|CAA74005.1| nitrate reductase (NADPH) [Parastagonospora nodorum] gi|3378500|emb|CAA08857.1| nitrate reductase [Parastagonospora nodorum] Length = 891 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 G SLVLICGPEALEKS HK LN +GW DEDL+FF Sbjct: 858 GSSLVLICGPEALEKSTHKALNEMGWRDEDLMFF 891 >gb|EKG14125.1| hypothetical protein MPH_08704 [Macrophomina phaseolina MS6] Length = 873 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 9 ESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 ++LVL+CGPEALEKSAHK LN +GW DEDLLFF Sbjct: 841 DTLVLLCGPEALEKSAHKALNEIGWKDEDLLFF 873 >gb|KKY23157.1| putative nitrate reductase [Diplodia seriata] Length = 678 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 9 ESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 +SLVL+CGPEALEKSAH LN +GW DEDLLFF Sbjct: 646 DSLVLLCGPEALEKSAHAALNEIGWKDEDLLFF 678 >ref|XP_007831791.1| Nitrate reductase [NADPH] [Pestalotiopsis fici W106-1] gi|573063492|gb|ETS83143.1| Nitrate reductase [NADPH] [Pestalotiopsis fici W106-1] Length = 901 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVL+CGPEALEKS H A+GW DEDLLFF Sbjct: 868 GEQLVLVCGPEALEKSVHSTFTAMGWRDEDLLFF 901 >ref|XP_007289633.1| nitrate reductase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866753|gb|EKD19792.1| nitrate reductase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 973 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVLICGPEALEKS H LN +GW D+DLLFF Sbjct: 940 GEDLVLICGPEALEKSVHGFLNDMGWKDDDLLFF 973 >ref|XP_008087137.1| Oxidoreductase molybdopterin-binding protein [Glarea lozoyensis ATCC 20868] gi|361130894|gb|EHL02631.1| putative Nitrate reductase [Glarea lozoyensis 74030] gi|512196982|gb|EPE25818.1| Oxidoreductase molybdopterin-binding protein [Glarea lozoyensis ATCC 20868] Length = 903 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVLICGPE LEKS H LN +GW D+DLLFF Sbjct: 870 GEELVLICGPETLEKSVHGFLNDMGWKDDDLLFF 903 >gb|KIW08956.1| hypothetical protein PV09_00868 [Verruconis gallopava] Length = 877 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 9 ESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 +S+VLICGPEALEK+ HK LN+ GW D+DLLFF Sbjct: 845 DSMVLICGPEALEKNVHKILNSQGWEDKDLLFF 877 >gb|EMR91014.1| putative nitrate reductase protein [Botrytis cinerea BcDW1] Length = 908 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVLICGPEALEKS H L+ LGW D+D+LFF Sbjct: 875 GEQLVLICGPEALEKSVHGILSDLGWKDQDILFF 908 >gb|EMF15198.1| nitrate reductase [NADPH] [Sphaerulina musiva SO2202] Length = 906 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE++VLICGPEALEKS H L LGW DE+L+FF Sbjct: 873 GEAMVLICGPEALEKSCHTALRELGWRDEELMFF 906 >emb|CCD46109.1| NiaD, nitrate reductase [Botrytis cinerea T4] Length = 907 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVLICGPEALEKS H L+ LGW D+D+LFF Sbjct: 874 GEQLVLICGPEALEKSVHGILSDLGWKDQDILFF 907 >ref|XP_003849160.1| hypothetical protein MYCGRDRAFT_111003 [Zymoseptoria tritici IPO323] gi|339469036|gb|EGP84136.1| hypothetical protein MYCGRDRAFT_111003 [Zymoseptoria tritici IPO323] Length = 845 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE++VLICGPEALEKS H L LGW DE+LLFF Sbjct: 812 GEAMVLICGPEALEKSCHTALLELGWKDEELLFF 845 >ref|XP_001551502.1| hypothetical protein BC1G_09772 [Botrytis cinerea B05.10] Length = 907 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 GESLVLICGPEALEKSAHKELNALGWPDEDLLFF 107 GE LVLICGPEALEKS H L+ LGW D+D+LFF Sbjct: 874 GEQLVLICGPEALEKSVHGILSDLGWKDQDILFF 907