BLASTX nr result
ID: Anemarrhena21_contig00065923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065923 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_034410974.1| hypothetical protein [Derxia gummosa] 60 7e-07 >ref|WP_034410974.1| hypothetical protein [Derxia gummosa] Length = 87 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -2 Query: 299 WFRRGCGSGVGHAEHQSARKTTGNKVTANDSTFALAA 189 WFRRG S GH EHQ ARK+TGN+VTAND FALAA Sbjct: 51 WFRRGLRSSAGHTEHQFARKSTGNEVTANDERFALAA 87