BLASTX nr result
ID: Anemarrhena21_contig00065712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065712 (225 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFY59766.1| hypothetical protein V496_05534 [Pseudogymnoascus... 60 8e-07 ref|XP_003171394.1| secreted protein [Microsporum gypseum CBS 11... 58 3e-06 gb|KFY35989.1| hypothetical protein V494_05420 [Pseudogymnoascus... 57 5e-06 gb|KFY15168.1| hypothetical protein V492_02187 [Pseudogymnoascus... 57 5e-06 gb|KFY81699.1| hypothetical protein V500_11171 [Pseudogymnoascus... 57 6e-06 ref|XP_002846155.1| secreted protein [Arthroderma otae CBS 11348... 57 6e-06 >gb|KFY59766.1| hypothetical protein V496_05534 [Pseudogymnoascus pannorum VKM F-4515 (FW-2607)] gi|682423733|gb|KFY92037.1| hypothetical protein V498_05186 [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 206 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 111 ILDKRTPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 +L RTPPNIPST+ AKS LAGLTVA QGSQ GYSRD Sbjct: 20 VLVARTPPNIPSTTEAKSALAGLTVAAQGSQDGYSRD 56 >ref|XP_003171394.1| secreted protein [Microsporum gypseum CBS 118893] gi|311343737|gb|EFR02940.1| secreted protein [Microsporum gypseum CBS 118893] Length = 204 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 96 TPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 TPPNIPS S+A+SLLAGLTVAPQG Q GYSRD Sbjct: 23 TPPNIPSASTAQSLLAGLTVAPQGPQDGYSRD 54 >gb|KFY35989.1| hypothetical protein V494_05420 [Pseudogymnoascus pannorum VKM F-4513 (FW-928)] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 99 RTPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 RTPPN+PSTS AKS LA LTVA QGSQ GYSRD Sbjct: 24 RTPPNVPSTSEAKSTLASLTVAAQGSQDGYSRD 56 >gb|KFY15168.1| hypothetical protein V492_02187 [Pseudogymnoascus pannorum VKM F-4246] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 99 RTPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 RTPPN+PSTS AKS LA LTVA QGSQ GYSRD Sbjct: 24 RTPPNVPSTSEAKSTLASLTVAAQGSQDGYSRD 56 >gb|KFY81699.1| hypothetical protein V500_11171 [Pseudogymnoascus pannorum VKM F-4518 (FW-2643)] gi|682439778|gb|KFZ03402.1| hypothetical protein V502_10973 [Pseudogymnoascus pannorum VKM F-4520 (FW-2644)] Length = 206 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 99 RTPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 RTPPNIP+T++AK+ LAGLTVA QGSQ GYSRD Sbjct: 24 RTPPNIPTTAAAKTALAGLTVAAQGSQDGYSRD 56 >ref|XP_002846155.1| secreted protein [Arthroderma otae CBS 113480] gi|238843543|gb|EEQ33205.1| secreted protein [Arthroderma otae CBS 113480] Length = 204 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 96 TPPNIPSTSSAKSLLAGLTVAPQGSQTGYSRD 1 TPPNIPS S+A+SLL+GLTVAPQG Q GYSRD Sbjct: 23 TPPNIPSASTAQSLLSGLTVAPQGPQDGYSRD 54