BLASTX nr result
ID: Anemarrhena21_contig00065513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065513 (361 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001802339.1| hypothetical protein SNOG_12105 [Phaeosphaer... 60 7e-07 ref|XP_008022484.1| hypothetical protein SETTUDRAFT_37528 [Setos... 56 8e-06 ref|XP_003298983.1| hypothetical protein PTT_09874 [Pyrenophora ... 56 8e-06 ref|XP_001933592.1| predicted protein [Pyrenophora tritici-repen... 56 8e-06 >ref|XP_001802339.1| hypothetical protein SNOG_12105 [Phaeosphaeria nodorum SN15] gi|111059397|gb|EAT80517.1| hypothetical protein SNOG_12105 [Phaeosphaeria nodorum SN15] Length = 245 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 360 DVTDAMFKSHVNRAIASGEKNGDFTRPKGASGTVKL 253 +V+D FK HVNRAI SGE+ GDF+RPKGASGTVKL Sbjct: 60 NVSDTAFKGHVNRAITSGEEKGDFSRPKGASGTVKL 95 >ref|XP_008022484.1| hypothetical protein SETTUDRAFT_37528 [Setosphaeria turcica Et28A] gi|482813178|gb|EOA89882.1| hypothetical protein SETTUDRAFT_37528 [Setosphaeria turcica Et28A] Length = 284 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 360 DVTDAMFKSHVNRAIASGEKNGDFTRPKGASGTVKL 253 ++TD F+ HVNRAIASGE+ GDF RPKG SG VKL Sbjct: 58 NLTDVAFRGHVNRAIASGEERGDFARPKGTSGPVKL 93 >ref|XP_003298983.1| hypothetical protein PTT_09874 [Pyrenophora teres f. teres 0-1] gi|311327547|gb|EFQ92932.1| hypothetical protein PTT_09874 [Pyrenophora teres f. teres 0-1] Length = 265 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 360 DVTDAMFKSHVNRAIASGEKNGDFTRPKGASGTVKL 253 +++DA F+SHVNRAI SGE+ GDF RPKG SG VKL Sbjct: 58 NLSDAAFRSHVNRAITSGEEKGDFARPKGTSGPVKL 93 >ref|XP_001933592.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979156|gb|EDU45782.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 267 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 360 DVTDAMFKSHVNRAIASGEKNGDFTRPKGASGTVKL 253 +++DA F+SHVNRAI SGE+ GDF RPKG SG VKL Sbjct: 58 NLSDAAFRSHVNRAITSGEEKGDFARPKGTSGPVKL 93