BLASTX nr result
ID: Anemarrhena21_contig00065494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065494 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003305504.1| hypothetical protein PTT_18365 [Pyrenophora ... 115 1e-23 ref|XP_001934503.1| conserved hypothetical protein [Pyrenophora ... 115 1e-23 ref|XP_003835171.1| hypothetical protein LEMA_P045120.1 [Leptosp... 115 2e-23 ref|XP_008021174.1| hypothetical protein SETTUDRAFT_162757 [Seto... 114 2e-23 ref|XP_007689766.1| hypothetical protein COCMIDRAFT_38376 [Bipol... 112 7e-23 gb|EMD97653.1| hypothetical protein COCHEDRAFT_1019025 [Bipolari... 112 1e-22 ref|XP_007704084.1| hypothetical protein COCSADRAFT_40440 [Bipol... 112 1e-22 ref|XP_007717333.1| hypothetical protein COCCADRAFT_109361 [Bipo... 112 1e-22 ref|XP_007581003.1| putative mitochondrial carrier protein [Neof... 100 5e-19 gb|KKY16618.1| putative mitochondrial carrier protein [Diplodia ... 99 1e-18 gb|EKG21496.1| Mitochondrial substrate/solute carrier [Macrophom... 99 1e-18 ref|XP_008086522.1| Mitochondrial carrier [Glarea lozoyensis ATC... 92 1e-16 ref|XP_007778185.1| hypothetical protein W97_02093 [Coniosporium... 91 4e-16 ref|XP_007915245.1| putative mitochondrial carrier protein [Togn... 90 5e-16 gb|KKY38066.1| putative mitochondrial carrier protein [Diaporthe... 89 1e-15 gb|ELQ38670.1| integral membrane ornithine transporter of mitoch... 89 2e-15 ref|XP_003709394.1| hypothetical protein MGG_11878 [Magnaporthe ... 89 2e-15 gb|KLU81674.1| hypothetical protein MAPG_00759 [Magnaporthiopsis... 88 3e-15 gb|KHJ30437.1| putative mitochondrial carrier protein [Erysiphe ... 87 6e-15 gb|ESZ91691.1| hypothetical protein SBOR_7948 [Sclerotinia borea... 87 6e-15 >ref|XP_003305504.1| hypothetical protein PTT_18365 [Pyrenophora teres f. teres 0-1] gi|311317440|gb|EFQ86396.1| hypothetical protein PTT_18365 [Pyrenophora teres f. teres 0-1] Length = 358 Score = 115 bits (288), Expect = 1e-23 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLVKHRGW GLYSGFHLHLLRD+IGTGIYF+TYES KQ+LANARG Sbjct: 197 IRKSYQNLGTWKTAQNLVKHRGWGGLYSGFHLHLLRDSIGTGIYFVTYESVKQILANARG 256 >ref|XP_001934503.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980382|gb|EDU47008.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 358 Score = 115 bits (288), Expect = 1e-23 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLVKHRGW GLYSGFHLHLLRD+IGTGIYF+TYES KQ+LANARG Sbjct: 197 IRKSYQNLGTWKTAQNLVKHRGWGGLYSGFHLHLLRDSIGTGIYFVTYESVKQILANARG 256 >ref|XP_003835171.1| hypothetical protein LEMA_P045120.1 [Leptosphaeria maculans JN3] gi|312211722|emb|CBX91806.1| hypothetical protein LEMA_P045120.1 [Leptosphaeria maculans JN3] Length = 358 Score = 115 bits (287), Expect = 2e-23 Identities = 51/60 (85%), Positives = 58/60 (96%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNL+KHRGW GLYSGFHLHLLRD+IGTGIYF+TYES KQ+LANARG Sbjct: 197 IRKSYQNLGTWKTAQNLIKHRGWRGLYSGFHLHLLRDSIGTGIYFLTYESVKQVLANARG 256 >ref|XP_008021174.1| hypothetical protein SETTUDRAFT_162757 [Setosphaeria turcica Et28A] gi|482815663|gb|EOA92338.1| hypothetical protein SETTUDRAFT_162757 [Setosphaeria turcica Et28A] Length = 358 Score = 114 bits (286), Expect = 2e-23 Identities = 51/60 (85%), Positives = 58/60 (96%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLV+HRGW GLYSGFHLHLLRD+IGTGIYF+TYES KQ+LANARG Sbjct: 197 IRKSYQNLGTWKTAQNLVRHRGWRGLYSGFHLHLLRDSIGTGIYFVTYESVKQVLANARG 256 >ref|XP_007689766.1| hypothetical protein COCMIDRAFT_38376 [Bipolaris oryzae ATCC 44560] gi|576930126|gb|EUC43715.1| hypothetical protein COCMIDRAFT_38376 [Bipolaris oryzae ATCC 44560] Length = 358 Score = 112 bits (281), Expect = 7e-23 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLV+HRGW GLYSGFHLHLLRD+IGTGIYFITYES KQ+LA ARG Sbjct: 197 IRKSYQNLGTWKTAQNLVRHRGWSGLYSGFHLHLLRDSIGTGIYFITYESVKQVLAKARG 256 >gb|EMD97653.1| hypothetical protein COCHEDRAFT_1019025 [Bipolaris maydis C5] gi|477585862|gb|ENI02949.1| hypothetical protein COCC4DRAFT_33343 [Bipolaris maydis ATCC 48331] Length = 358 Score = 112 bits (280), Expect = 1e-22 Identities = 50/60 (83%), Positives = 57/60 (95%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNL++HRGW GLYSGFHLHLLRD+IGTGIYFITYES KQ+LA ARG Sbjct: 197 IRKSYQNLGTWKTAQNLIRHRGWSGLYSGFHLHLLRDSIGTGIYFITYESVKQVLAKARG 256 >ref|XP_007704084.1| hypothetical protein COCSADRAFT_40440 [Bipolaris sorokiniana ND90Pr] gi|451846691|gb|EMD60000.1| hypothetical protein COCSADRAFT_40440 [Bipolaris sorokiniana ND90Pr] Length = 358 Score = 112 bits (280), Expect = 1e-22 Identities = 50/60 (83%), Positives = 57/60 (95%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLV+HRGW GLYSGFHLHLLRD+IGTGIYF+TYES KQ+LA ARG Sbjct: 197 IRKSYQNLGTWKTAQNLVRHRGWSGLYSGFHLHLLRDSIGTGIYFVTYESVKQVLAKARG 256 >ref|XP_007717333.1| hypothetical protein COCCADRAFT_109361 [Bipolaris zeicola 26-R-13] gi|576913979|gb|EUC28367.1| hypothetical protein COCCADRAFT_109361 [Bipolaris zeicola 26-R-13] gi|578483271|gb|EUN20851.1| hypothetical protein COCVIDRAFT_115510 [Bipolaris victoriae FI3] Length = 358 Score = 112 bits (279), Expect = 1e-22 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = -2 Query: 183 LRKSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +RKSYQNLGT++TAQNLV+HRGW GLYSGFHLHLLRD+IGTGIYFITYES KQ+LA ARG Sbjct: 197 IRKSYQNLGTWKTAQNLVRHRGWGGLYSGFHLHLLRDSIGTGIYFITYESVKQVLAKARG 256 >ref|XP_007581003.1| putative mitochondrial carrier protein [Neofusicoccum parvum UCRNP2] gi|485927535|gb|EOD51510.1| putative mitochondrial carrier protein [Neofusicoccum parvum UCRNP2] Length = 313 Score = 100 bits (248), Expect = 5e-19 Identities = 47/59 (79%), Positives = 52/59 (88%) Frame = -2 Query: 177 KSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 +SY LGTFRTAQ +VKHRG GLY+G H HLLRDTIGTGIYF+TYES+KQLLANARGN Sbjct: 193 QSYAELGTFRTAQMVVKHRGMSGLYAGVHYHLLRDTIGTGIYFMTYESSKQLLANARGN 251 >gb|KKY16618.1| putative mitochondrial carrier protein [Diplodia seriata] Length = 296 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/59 (79%), Positives = 52/59 (88%) Frame = -2 Query: 177 KSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 +SY LGTFRTAQ +VKHRG GLY+G H HLLRDTIGTGIYF+TYES+KQLLANARGN Sbjct: 132 QSYAELGTFRTAQMVVKHRGLGGLYAGVHYHLLRDTIGTGIYFMTYESSKQLLANARGN 190 >gb|EKG21496.1| Mitochondrial substrate/solute carrier [Macrophomina phaseolina MS6] Length = 352 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/59 (79%), Positives = 52/59 (88%) Frame = -2 Query: 177 KSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 +SY LGTFRTAQ +VKHRG GLY+G H HLLRDTIGTGIYF+TYES+KQLLANARGN Sbjct: 193 QSYAELGTFRTAQMVVKHRGLGGLYAGVHYHLLRDTIGTGIYFMTYESSKQLLANARGN 251 >ref|XP_008086522.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868] gi|512198497|gb|EPE27332.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868] Length = 334 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 SYQN GTF+TA+N+VKHRG+ GLYSGF+LHL+RDT+GT IYF+TYES+KQLL G+ Sbjct: 183 SYQNKGTFQTAKNIVKHRGFAGLYSGFNLHLMRDTLGTAIYFMTYESSKQLLTTYSGD 240 >ref|XP_007778185.1| hypothetical protein W97_02093 [Coniosporium apollinis CBS 100218] gi|494825714|gb|EON62868.1| hypothetical protein W97_02093 [Coniosporium apollinis CBS 100218] Length = 296 Score = 90.5 bits (223), Expect = 4e-16 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -2 Query: 177 KSYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 +SYQ +GT +TA+ +VKHRG+ GLYSG HLLRDTIGT IYF+TYESAKQ+LAN RG Sbjct: 134 QSYQQMGTIKTARAIVKHRGFRGLYSGLQFHLLRDTIGTAIYFMTYESAKQVLANGRG 191 >ref|XP_007915245.1| putative mitochondrial carrier protein [Togninia minima UCRPA7] gi|500256843|gb|EOO00084.1| putative mitochondrial carrier protein [Togninia minima UCRPA7] Length = 346 Score = 90.1 bits (222), Expect = 5e-16 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 SYQN GTF+T +N+VKHRG GLY+GF+LHLLRDT+GTGIYF+TYES+KQLL G+ Sbjct: 195 SYQNKGTFKTMRNIVKHRGLGGLYTGFNLHLLRDTLGTGIYFMTYESSKQLLTTFGGD 252 >gb|KKY38066.1| putative mitochondrial carrier protein [Diaporthe ampelina] Length = 374 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 SYQN GTF+T N+++HRG +GLY+GF+LHLLRDT+GTGIYF+TYES+KQLL G+ Sbjct: 222 SYQNKGTFKTMANIIRHRGPLGLYTGFNLHLLRDTLGTGIYFMTYESSKQLLTTFGGD 279 >gb|ELQ38670.1| integral membrane ornithine transporter of mitochondria [Magnaporthe oryzae Y34] gi|440482859|gb|ELQ63311.1| integral membrane ornithine transporter of mitochondria [Magnaporthe oryzae P131] Length = 375 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 SYQN GT++T +N+V+HRG+ GLY+GF LHLLRDT+GTG+YF+TYESAKQ+L + G Sbjct: 224 SYQNKGTWQTMKNIVRHRGYSGLYTGFSLHLLRDTLGTGLYFMTYESAKQILTSLSG 280 >ref|XP_003709394.1| hypothetical protein MGG_11878 [Magnaporthe oryzae 70-15] gi|351648923|gb|EHA56782.1| hypothetical protein MGG_11878 [Magnaporthe oryzae 70-15] Length = 396 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/57 (66%), Positives = 50/57 (87%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 SYQN GT++T +N+V+HRG+ GLY+GF LHLLRDT+GTG+YF+TYESAKQ+L + G Sbjct: 245 SYQNKGTWQTMKNIVRHRGYSGLYTGFSLHLLRDTLGTGLYFMTYESAKQILTSLSG 301 >gb|KLU81674.1| hypothetical protein MAPG_00759 [Magnaporthiopsis poae ATCC 64411] Length = 385 Score = 87.8 bits (216), Expect = 3e-15 Identities = 37/58 (63%), Positives = 50/58 (86%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 SYQN GT++T +N+V+HRG+ GLY+GF LH+LRDT+GTG+YF+TYESAKQ+L G+ Sbjct: 234 SYQNKGTWQTMRNIVRHRGFTGLYTGFQLHILRDTLGTGLYFMTYESAKQILTTLSGS 291 >gb|KHJ30437.1| putative mitochondrial carrier protein [Erysiphe necator] Length = 349 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARGN 1 +YQN GTF TA+N++K+RG +GLY+GFHLHLLRDT+GT YF+TYESAKQ+L N Sbjct: 198 TYQNKGTFMTAKNIIKNRGILGLYTGFHLHLLRDTLGTATYFMTYESAKQVLTTVSPN 255 >gb|ESZ91691.1| hypothetical protein SBOR_7948 [Sclerotinia borealis F-4157] Length = 351 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -2 Query: 174 SYQNLGTFRTAQNLVKHRGWMGLYSGFHLHLLRDTIGTGIYFITYESAKQLLANARG 4 SY++ GTF+TA N++KHRG GLYSGF+LHLLRDT+GT IYF+TYES KQLL G Sbjct: 200 SYKDKGTFKTAMNIIKHRGVSGLYSGFNLHLLRDTLGTAIYFMTYESCKQLLTTYTG 256