BLASTX nr result
ID: Anemarrhena21_contig00065399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065399 (327 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008796826.1| PREDICTED: probable lipid phosphate phosphat... 57 4e-06 >ref|XP_008796826.1| PREDICTED: probable lipid phosphate phosphatase beta [Phoenix dactylifera] Length = 188 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 311 STALRPRCHPIPRSLLKTLEISGDGCLWFPIPIAFLLFSS 192 S + C P+PRSLLK LEISGDG WFPIP+A L FSS Sbjct: 32 SLRIHSLCRPVPRSLLKALEISGDGRFWFPIPLALLPFSS 71