BLASTX nr result
ID: Anemarrhena21_contig00065349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065349 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009219617.1| hypothetical protein GGTG_03572 [Gaeumannomy... 66 1e-08 ref|XP_009219701.1| hypothetical protein GGTG_03656 [Gaeumannomy... 56 8e-06 >ref|XP_009219617.1| hypothetical protein GGTG_03572 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402083454|gb|EJT78472.1| hypothetical protein GGTG_03572 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 76 Score = 65.9 bits (159), Expect = 1e-08 Identities = 35/72 (48%), Positives = 42/72 (58%) Frame = -3 Query: 242 QVPPINMRTVIISARYFDSPALENFFLQTFGPNVAEVKWTRGKYQCTIPRLLRPNEIESL 63 Q PP +T II ARY D LE F L FGP +V WTRG YQC +PR LR E+E L Sbjct: 6 QQPP--RKTAIIQARYMDQMELELFLLGLFGPGKCDVTWTRGFYQCVLPRGLRRPELERL 63 Query: 62 RQVVQVEHYQEV 27 + +E Y+ V Sbjct: 64 AAKIGMERYKIV 75 >ref|XP_009219701.1| hypothetical protein GGTG_03656 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402083538|gb|EJT78556.1| hypothetical protein GGTG_03656 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 136 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = -3 Query: 221 RTVIISARYFDSPALENFFLQTFGPNVAEVKWTRGKYQCTIPRLLRPNEIESLRQ 57 RTV+I ARY D L F ++ FG N EV+W RG YQC +PR L+P L Q Sbjct: 10 RTVLIHARYIDDFPLMTFLVRLFGANECEVEWKRGYYQCILPRGLKPVSTAQLGQ 64