BLASTX nr result
ID: Anemarrhena21_contig00065212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065212 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003295945.1| hypothetical protein PTT_03999 [Pyrenophora ... 76 1e-11 >ref|XP_003295945.1| hypothetical protein PTT_03999 [Pyrenophora teres f. teres 0-1] gi|311332298|gb|EFQ95956.1| hypothetical protein PTT_03999 [Pyrenophora teres f. teres 0-1] Length = 215 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/67 (49%), Positives = 41/67 (61%) Frame = -3 Query: 202 GIRNLNITPNRDREQCSTCRKWFPSRYKLDVHKLELPSGCEEHGVCFGVEEEHYHGTSWR 23 G +L + N +R QCS C +WF KL H+ ELP GCEE G+C E+ +HG R Sbjct: 123 GTHSLTASANPERSQCSVCSQWFADESKLAHHQWELPVGCEECGICLREEDVGWHGAGVR 182 Query: 22 HERCFVR 2 HERCFVR Sbjct: 183 HERCFVR 189