BLASTX nr result
ID: Anemarrhena21_contig00065091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065091 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008785127.1| PREDICTED: transcription factor E2FB-like [P... 57 4e-06 ref|XP_010059189.1| PREDICTED: transcription factor E2FA [Eucaly... 57 6e-06 >ref|XP_008785127.1| PREDICTED: transcription factor E2FB-like [Phoenix dactylifera] Length = 420 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 4/72 (5%) Frame = -1 Query: 206 LGAVQQEHSATIHMLPPVSRAGDKCQKKPKASK-RKGFLPQTPESADGSTSAANN---CR 39 +G Q+E + + H+LP S G KC +KP+ SK +K Q P A+G+ S N CR Sbjct: 87 IGQRQKEETGS-HILPTESGTGVKCPRKPQHSKHKKAVQQQLPGLAEGNVSNILNPSSCR 145 Query: 38 YDSSLGLLTKKF 3 YDSSLGLLTKKF Sbjct: 146 YDSSLGLLTKKF 157 >ref|XP_010059189.1| PREDICTED: transcription factor E2FA [Eucalyptus grandis] gi|629126054|gb|KCW90479.1| hypothetical protein EUGRSUZ_A02602 [Eucalyptus grandis] gi|629126055|gb|KCW90480.1| hypothetical protein EUGRSUZ_A02602 [Eucalyptus grandis] Length = 476 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/55 (58%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Frame = -1 Query: 158 PVSRAGDKCQKKPKASKRKGFLPQTPESADGSTSA---ANNCRYDSSLGLLTKKF 3 PVS G K + K SK PQTP S DGS +A A NCRYDSSL LLTKKF Sbjct: 111 PVSAKGGKAYNRSKGSKANKSGPQTPLSNDGSPAALTPAGNCRYDSSLSLLTKKF 165