BLASTX nr result
ID: Anemarrhena21_contig00065067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065067 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001793837.1| hypothetical protein SNOG_03267 [Phaeosphaer... 57 5e-06 >ref|XP_001793837.1| hypothetical protein SNOG_03267 [Phaeosphaeria nodorum SN15] gi|160705526|gb|EAT89998.2| hypothetical protein SNOG_03267 [Phaeosphaeria nodorum SN15] Length = 447 Score = 57.0 bits (136), Expect = 5e-06 Identities = 34/79 (43%), Positives = 53/79 (67%) Frame = -1 Query: 274 IILAYTAISLLVFLFNMFLQTCIKRRGTAYARANGQRHRNIEEDEENLVLKAYNMGKGSD 95 +IL +TA++LLVF+FN +Q+CI RRG+A+ARAN +R R E+D++ +L++ + S Sbjct: 344 VILGFTAVALLVFVFNTIVQSCIGRRGSAHARANNRR-RLGEDDDQVEMLRSRSSSNAS- 401 Query: 94 DYSRSNSQQSVDRPGMHGR 38 R S SV+ G HG+ Sbjct: 402 --FRKGSDGSVEF-GAHGQ 417