BLASTX nr result
ID: Anemarrhena21_contig00065051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00065051 (248 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007784907.1| hypothetical protein W97_08850 [Coniosporium... 80 7e-13 ref|XP_003840034.1| predicted protein [Leptosphaeria maculans JN... 78 2e-12 gb|EUN20831.1| hypothetical protein COCVIDRAFT_31848 [Bipolaris ... 75 2e-11 ref|XP_007710174.1| hypothetical protein COCCADRAFT_3315 [Bipola... 75 2e-11 ref|XP_008025746.1| hypothetical protein SETTUDRAFT_163277 [Seto... 75 2e-11 gb|EMD87918.1| hypothetical protein COCHEDRAFT_1197036 [Bipolari... 75 2e-11 ref|XP_007699159.1| hypothetical protein COCSADRAFT_36392 [Bipol... 75 2e-11 ref|XP_003306703.1| hypothetical protein PTT_19909 [Pyrenophora ... 75 2e-11 ref|XP_001936467.1| hypothetical protein PTRG_06134 [Pyrenophora... 75 2e-11 ref|XP_007683483.1| hypothetical protein COCMIDRAFT_1299 [Bipola... 73 8e-11 ref|XP_001800544.1| hypothetical protein SNOG_10265 [Phaeosphaer... 72 1e-10 emb|CCD54057.1| similar to arrestin (or S-antigen) [Botrytis cin... 69 2e-09 ref|XP_001595134.1| hypothetical protein SS1G_03222 [Sclerotinia... 69 2e-09 ref|XP_001554617.1| hypothetical protein BC1G_06760 [Botrytis ci... 69 2e-09 gb|KEQ93233.1| hypothetical protein AUEXF2481DRAFT_41955 [Aureob... 68 2e-09 gb|KIW03879.1| hypothetical protein PV09_05174 [Verruconis gallo... 68 3e-09 gb|ESZ95356.1| hypothetical protein SBOR_4290 [Sclerotinia borea... 67 4e-09 gb|KJK68489.1| ArrestinN terminal like [Aspergillus parasiticus ... 67 5e-09 ref|XP_007674627.1| hypothetical protein BAUCODRAFT_66794 [Baudo... 67 5e-09 ref|XP_001824097.1| arrestin (or S-antigen), N-terminal domain p... 67 5e-09 >ref|XP_007784907.1| hypothetical protein W97_08850 [Coniosporium apollinis CBS 100218] gi|494833687|gb|EON69590.1| hypothetical protein W97_08850 [Coniosporium apollinis CBS 100218] Length = 393 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTY-VNDFDLSHLDGE 113 F+L+LTERSG+GIAWDEEQPPMYEDVPASPPTY +ND D+ LD E Sbjct: 341 FNLLLTERSGLGIAWDEEQPPMYEDVPASPPTYQINDIDMQELDEE 386 >ref|XP_003840034.1| predicted protein [Leptosphaeria maculans JN3] gi|312216605|emb|CBX96555.1| predicted protein [Leptosphaeria maculans JN3] Length = 451 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVPASPPTYV+D Sbjct: 399 FHLVLTERSGMGIAWDEEQPPVYEDVPASPPTYVDD 434 >gb|EUN20831.1| hypothetical protein COCVIDRAFT_31848 [Bipolaris victoriae FI3] Length = 451 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPVSPPTYVEE 432 >ref|XP_007710174.1| hypothetical protein COCCADRAFT_3315 [Bipolaris zeicola 26-R-13] gi|576921374|gb|EUC35516.1| hypothetical protein COCCADRAFT_3315 [Bipolaris zeicola 26-R-13] Length = 451 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPVSPPTYVEE 432 >ref|XP_008025746.1| hypothetical protein SETTUDRAFT_163277 [Setosphaeria turcica Et28A] gi|482810496|gb|EOA87302.1| hypothetical protein SETTUDRAFT_163277 [Setosphaeria turcica Et28A] Length = 452 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 398 FHLVLTERSGMGIAWDEEQPPLYEDVPVSPPTYVEE 433 >gb|EMD87918.1| hypothetical protein COCHEDRAFT_1197036 [Bipolaris maydis C5] gi|477586348|gb|ENI03433.1| hypothetical protein COCC4DRAFT_73665 [Bipolaris maydis ATCC 48331] Length = 451 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPVSPPTYVEE 432 >ref|XP_007699159.1| hypothetical protein COCSADRAFT_36392 [Bipolaris sorokiniana ND90Pr] gi|451851745|gb|EMD65043.1| hypothetical protein COCSADRAFT_36392 [Bipolaris sorokiniana ND90Pr] Length = 451 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPVSPPTYVEE 432 >ref|XP_003306703.1| hypothetical protein PTT_19909 [Pyrenophora teres f. teres 0-1] gi|311315682|gb|EFQ85202.1| hypothetical protein PTT_19909 [Pyrenophora teres f. teres 0-1] Length = 451 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV++ Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPISPPTYVDE 432 >ref|XP_001936467.1| hypothetical protein PTRG_06134 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983566|gb|EDU49054.1| hypothetical protein PTRG_06134 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 451 Score = 74.7 bits (182), Expect = 2e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHLVLTERSGMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLVLTERSGMGIAWDEEQPPLYEDVPMSPPTYVEE 432 >ref|XP_007683483.1| hypothetical protein COCMIDRAFT_1299 [Bipolaris oryzae ATCC 44560] gi|576936388|gb|EUC49883.1| hypothetical protein COCMIDRAFT_1299 [Bipolaris oryzae ATCC 44560] Length = 451 Score = 72.8 bits (177), Expect = 8e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHL+LTER GMGIAWDEEQPP+YEDVP SPPTYV + Sbjct: 397 FHLILTERPGMGIAWDEEQPPLYEDVPVSPPTYVEE 432 >ref|XP_001800544.1| hypothetical protein SNOG_10265 [Phaeosphaeria nodorum SN15] gi|160707310|gb|EAT82600.2| hypothetical protein SNOG_10265 [Phaeosphaeria nodorum SN15] Length = 431 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND 140 FHL LTERSGMGIAWDEEQPP+YEDVP SPPTY+++ Sbjct: 379 FHLTLTERSGMGIAWDEEQPPVYEDVPCSPPTYMDE 414 >emb|CCD54057.1| similar to arrestin (or S-antigen) [Botrytis cinerea T4] Length = 471 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN 143 F+L +TERSG+GI+WDEEQPP+YE+VPASPPTYVN Sbjct: 408 FNLTVTERSGLGISWDEEQPPLYENVPASPPTYVN 442 >ref|XP_001595134.1| hypothetical protein SS1G_03222 [Sclerotinia sclerotiorum 1980] gi|154701010|gb|EDO00749.1| hypothetical protein SS1G_03222 [Sclerotinia sclerotiorum 1980 UF-70] Length = 470 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 11/55 (20%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN----------DF-DLSHLDG 116 F + +TERSG+GI+WDEEQPP+YE+VPASPPTYVN D+ DLS LDG Sbjct: 412 FKMTVTERSGLGISWDEEQPPLYENVPASPPTYVNSEVYDGPPIPDYEDLSALDG 466 >ref|XP_001554617.1| hypothetical protein BC1G_06760 [Botrytis cinerea B05.10] gi|472235753|gb|EMR80713.1| putative arrestin (or s-antigen) n-terminal domain protein [Botrytis cinerea BcDW1] Length = 475 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN 143 F+L +TERSG+GI+WDEEQPP+YE+VPASPPTYVN Sbjct: 412 FNLTVTERSGLGISWDEEQPPLYENVPASPPTYVN 446 >gb|KEQ93233.1| hypothetical protein AUEXF2481DRAFT_41955 [Aureobasidium subglaciale EXF-2481] Length = 442 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/46 (63%), Positives = 40/46 (86%), Gaps = 3/46 (6%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTY---VNDFDLSHLD 119 F++ +TERSGMGIAW++EQPP+YED+PASPP+Y +ND+D S L+ Sbjct: 388 FNINVTERSGMGIAWEDEQPPLYEDIPASPPSYRIEINDYDGSELN 433 >gb|KIW03879.1| hypothetical protein PV09_05174 [Verruconis gallopava] Length = 543 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/47 (61%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTY--VNDFDLSHLDGE 113 FHL+LTER G+G++WDEE PP+YEDVP SPP Y + DFD++ L G+ Sbjct: 416 FHLMLTERPGLGVSWDEETPPVYEDVPESPPHYASMTDFDMNVLGGQ 462 >gb|ESZ95356.1| hypothetical protein SBOR_4290 [Sclerotinia borealis F-4157] Length = 479 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN 143 F+L +TERSG+GI+WDEEQPP+YE+VPASPPTYVN Sbjct: 411 FNLNVTERSGLGISWDEEQPPLYENVPASPPTYVN 445 >gb|KJK68489.1| ArrestinN terminal like [Aspergillus parasiticus SU-1] Length = 535 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN 143 FHL +TERSG+GI+WDEE PPMYEDVPASPP Y N Sbjct: 419 FHLHVTERSGLGISWDEEMPPMYEDVPASPPGYTN 453 >ref|XP_007674627.1| hypothetical protein BAUCODRAFT_66794 [Baudoinia compniacensis UAMH 10762] gi|449301918|gb|EMC97927.1| hypothetical protein BAUCODRAFT_66794 [Baudoinia compniacensis UAMH 10762] Length = 388 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 6/51 (11%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVND------FDLSHLDGE 113 F+L +TER+G+GI+WD+EQPPMYEDVPASPP Y ND +D +++ GE Sbjct: 330 FNLNVTERAGLGISWDDEQPPMYEDVPASPPHYQNDHTSVHFYDENNIQGE 380 >ref|XP_001824097.1| arrestin (or S-antigen), N-terminal domain protein [Aspergillus oryzae RIB40] gi|238499889|ref|XP_002381179.1| arrestin (or S-antigen), N-terminal domain protein [Aspergillus flavus NRRL3357] gi|83772836|dbj|BAE62964.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220692932|gb|EED49278.1| arrestin (or S-antigen), N-terminal domain protein [Aspergillus flavus NRRL3357] gi|391873123|gb|EIT82197.1| arrestin (or S-antigen), nitrogen terminal domain protein [Aspergillus oryzae 3.042] gi|768707129|gb|KJJ33704.1| Arrestin N terminal like [Aspergillus flavus AF70] Length = 535 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 247 FHLVLTERSGMGIAWDEEQPPMYEDVPASPPTYVN 143 FHL +TERSG+GI+WDEE PPMYEDVPASPP Y N Sbjct: 419 FHLHVTERSGLGISWDEEMPPMYEDVPASPPGYTN 453