BLASTX nr result
ID: Anemarrhena21_contig00064886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064886 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX99277.1| mitochondrial import receptor subunit tom22 like ... 57 4e-06 ref|XP_003855424.1| hypothetical protein MYCGRDRAFT_103356 [Zymo... 57 4e-06 gb|EUN32780.1| hypothetical protein COCVIDRAFT_11274 [Bipolaris ... 57 5e-06 ref|XP_007682431.1| hypothetical protein COCMIDRAFT_80005 [Bipol... 57 5e-06 ref|XP_007718931.1| hypothetical protein COCCADRAFT_31532 [Bipol... 57 5e-06 gb|EMD90690.1| hypothetical protein COCHEDRAFT_1179781 [Bipolari... 57 5e-06 ref|XP_007705432.1| hypothetical protein COCSADRAFT_102966 [Bipo... 57 5e-06 ref|XP_003305250.1| hypothetical protein PTT_18049 [Pyrenophora ... 57 5e-06 ref|XP_001940224.1| mitochondrial import receptor subunit tom22 ... 57 5e-06 >gb|KJX99277.1| mitochondrial import receptor subunit tom22 like protein [Zymoseptoria brevis] Length = 142 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYSXXXXXXXXXXXXXXXXRANEFLT 103 G+S+ GKTLWVVSTSALLLGVPWALA+S ANE LT Sbjct: 81 GLSFSGKTLWVVSTSALLLGVPWALAFSEEQQYQEMEREMRMQQSANELLT 131 >ref|XP_003855424.1| hypothetical protein MYCGRDRAFT_103356 [Zymoseptoria tritici IPO323] gi|339475308|gb|EGP90400.1| hypothetical protein MYCGRDRAFT_103356 [Zymoseptoria tritici IPO323] Length = 142 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYSXXXXXXXXXXXXXXXXRANEFLT 103 G+S+ GKTLWVVSTSALLLGVPWALA+S ANE LT Sbjct: 81 GLSFSGKTLWVVSTSALLLGVPWALAFSEEQQYQEMEREMRMQQSANELLT 131 >gb|EUN32780.1| hypothetical protein COCVIDRAFT_11274 [Bipolaris victoriae FI3] Length = 154 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 87 GLSMGGKTLWVVSTSALLLGVPWALAYS 114 >ref|XP_007682431.1| hypothetical protein COCMIDRAFT_80005 [Bipolaris oryzae ATCC 44560] gi|576937612|gb|EUC51099.1| hypothetical protein COCMIDRAFT_80005 [Bipolaris oryzae ATCC 44560] Length = 145 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 78 GLSMGGKTLWVVSTSALLLGVPWALAYS 105 >ref|XP_007718931.1| hypothetical protein COCCADRAFT_31532 [Bipolaris zeicola 26-R-13] gi|576912047|gb|EUC26763.1| hypothetical protein COCCADRAFT_31532 [Bipolaris zeicola 26-R-13] Length = 154 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 87 GLSMGGKTLWVVSTSALLLGVPWALAYS 114 >gb|EMD90690.1| hypothetical protein COCHEDRAFT_1179781 [Bipolaris maydis C5] gi|477592027|gb|ENI09098.1| hypothetical protein COCC4DRAFT_186453 [Bipolaris maydis ATCC 48331] Length = 145 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 78 GLSMGGKTLWVVSTSALLLGVPWALAYS 105 >ref|XP_007705432.1| hypothetical protein COCSADRAFT_102966 [Bipolaris sorokiniana ND90Pr] gi|451845671|gb|EMD58983.1| hypothetical protein COCSADRAFT_102966 [Bipolaris sorokiniana ND90Pr] Length = 145 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 78 GLSMGGKTLWVVSTSALLLGVPWALAYS 105 >ref|XP_003305250.1| hypothetical protein PTT_18049 [Pyrenophora teres f. teres 0-1] gi|311317799|gb|EFQ86661.1| hypothetical protein PTT_18049 [Pyrenophora teres f. teres 0-1] Length = 146 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 78 GLSMGGKTLWVVSTSALLLGVPWALAYS 105 >ref|XP_001940224.1| mitochondrial import receptor subunit tom22 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976317|gb|EDU42943.1| mitochondrial import receptor subunit tom22 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 146 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 255 GISYGGKTLWVVSTSALLLGVPWALAYS 172 G+S GGKTLWVVSTSALLLGVPWALAYS Sbjct: 78 GLSMGGKTLWVVSTSALLLGVPWALAYS 105