BLASTX nr result
ID: Anemarrhena21_contig00064834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064834 (551 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001806222.1| hypothetical protein SNOG_16094 [Phaeosphaer... 61 4e-07 ref|XP_007705468.1| hypothetical protein COCSADRAFT_262787 [Bipo... 60 5e-07 ref|XP_003301962.1| hypothetical protein PTT_13620 [Pyrenophora ... 59 1e-06 >ref|XP_001806222.1| hypothetical protein SNOG_16094 [Phaeosphaeria nodorum SN15] gi|160705696|gb|EAT76466.2| hypothetical protein SNOG_16094 [Phaeosphaeria nodorum SN15] Length = 501 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 7/63 (11%) Frame = -2 Query: 172 ILELQLPQPMPHAVPRERSLDFYS------SKFEPTRQMQLPIPRISAGH-HEMDALRTA 14 +LELQLP+PMPHA+PRE DFY+ SK + T MQLP+PR++ GH H A T Sbjct: 1 MLELQLPRPMPHALPREPPFDFYASSSRSMSKLDST--MQLPMPRMATGHDHVQRAPLTP 58 Query: 13 PRP 5 PRP Sbjct: 59 PRP 61 >ref|XP_007705468.1| hypothetical protein COCSADRAFT_262787 [Bipolaris sorokiniana ND90Pr] gi|451845718|gb|EMD59030.1| hypothetical protein COCSADRAFT_262787 [Bipolaris sorokiniana ND90Pr] Length = 620 Score = 60.5 bits (145), Expect = 5e-07 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Frame = -2 Query: 172 ILELQLPQPMPHAVPRERSLDFY------SSKFEPTRQMQLPIPRISAGHHEMDALRTAP 11 +LELQLP+PMPHA+PRE S FY SSK + T MQLP PR+ A ++ D LRTA Sbjct: 1 MLELQLPRPMPHAIPREHSFTFYAPGPQPSSKLDTT--MQLPYPRM-ANAYDHDPLRTAS 57 Query: 10 RPP 2 R P Sbjct: 58 RAP 60 >ref|XP_003301962.1| hypothetical protein PTT_13620 [Pyrenophora teres f. teres 0-1] gi|311322919|gb|EFQ89931.1| hypothetical protein PTT_13620 [Pyrenophora teres f. teres 0-1] Length = 620 Score = 59.3 bits (142), Expect = 1e-06 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 7/64 (10%) Frame = -2 Query: 172 ILELQLPQP-MPHAVPRERSLDFY------SSKFEPTRQMQLPIPRISAGHHEMDALRTA 14 +LELQLP+P MPHA+PRE + + SSK + T MQLP PRIS G +E D+LRTA Sbjct: 1 MLELQLPRPPMPHAIPREPPFNLFAPTSHTSSKLDTT--MQLPYPRISNG-YEQDSLRTA 57 Query: 13 PRPP 2 PR P Sbjct: 58 PRAP 61