BLASTX nr result
ID: Anemarrhena21_contig00064802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064802 (267 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosp... 80 4e-13 ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres ... 80 5e-13 ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritic... 80 7e-13 ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaer... 79 9e-13 ref|XP_007690984.1| hypothetical protein COCMIDRAFT_103365 [Bipo... 79 1e-12 gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO... 79 1e-12 ref|XP_007706676.1| hypothetical protein COCCADRAFT_21712 [Bipol... 79 1e-12 gb|KIX02138.1| 40S ribosomal protein S6-B [Rhinocladiella macken... 79 2e-12 ref|XP_008021674.1| hypothetical protein SETTUDRAFT_102110 [Seto... 79 2e-12 ref|XP_007676134.1| hypothetical protein BAUCODRAFT_34032 [Baudo... 78 2e-12 gb|KIW49324.1| 40S ribosomal protein S6-B [Exophiala xenobiotica] 78 3e-12 gb|KIW45626.1| 40S ribosomal protein S6-B, variant [Exophiala ol... 78 3e-12 gb|KIW45625.1| 40S ribosomal protein S6-B [Exophiala oligosperma] 78 3e-12 gb|KIW16184.1| 40S ribosomal protein S6-B [Exophiala spinifera] 78 3e-12 ref|XP_007921818.1| hypothetical protein MYCFIDRAFT_181407 [Pseu... 78 3e-12 gb|KKY22176.1| putative 40s ribosomal protein s6 [Phaeomoniella ... 77 3e-12 gb|KIV98223.1| 40S ribosomal protein S6-A, variant [Exophiala me... 77 3e-12 gb|KIV98222.1| 40S ribosomal protein S6-A [Exophiala mesophila] 77 3e-12 gb|KIV80959.1| 40S ribosomal protein S6-B, variant [Exophiala si... 77 5e-12 gb|KIV80958.1| 40S ribosomal protein S6-B [Exophiala sideris] 77 5e-12 >ref|XP_003836586.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] gi|312213139|emb|CBX93221.1| hypothetical protein LEMA_P041220.1 [Leptosphaeria maculans JN3] Length = 313 Score = 80.5 bits (197), Expect = 4e-13 Identities = 44/61 (72%), Positives = 44/61 (72%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRIXXXXXXXXXXXXXXXXSMR 87 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQIL KRI SMR Sbjct: 253 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILSKRISDAKAAHDEARKRRASSMR 312 Query: 86 H 84 H Sbjct: 313 H 313 >ref|XP_003306964.1| 40S ribosomal protein S6 [Pyrenophora teres f. teres 0-1] gi|311315235|gb|EFQ84937.1| hypothetical protein PTT_20282 [Pyrenophora teres f. teres 0-1] Length = 239 Score = 80.1 bits (196), Expect = 5e-13 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQIL KRI Sbjct: 179 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILSKRI 219 >ref|XP_001935910.1| 40S ribosomal protein S6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983009|gb|EDU48497.1| 40S ribosomal protein S6-B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 239 Score = 79.7 bits (195), Expect = 7e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQIL KRI Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILSKRI 219 >ref|XP_001797870.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] gi|111063881|gb|EAT85001.1| hypothetical protein SNOG_07535 [Phaeosphaeria nodorum SN15] Length = 239 Score = 79.3 bits (194), Expect = 9e-13 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRIXXXXXXXXXXXXXXXXSMR 87 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQIL KR+ SMR Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILQKRLGQAKAAHDEARKRRASSMR 238 Query: 86 H 84 H Sbjct: 239 H 239 >ref|XP_007690984.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris oryzae ATCC 44560] gi|576928872|gb|EUC42499.1| hypothetical protein COCMIDRAFT_103365 [Bipolaris oryzae ATCC 44560] Length = 239 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQIL KRI Sbjct: 179 QRLVTPQRLQHKRHRLALKRRRAEASKDAANEYAQILSKRI 219 >gb|EMF16436.1| 40S ribosomal protein S6-B [Sphaerulina musiva SO2202] Length = 241 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 181 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQVLHKRV 221 >ref|XP_007706676.1| hypothetical protein COCCADRAFT_21712 [Bipolaris zeicola 26-R-13] gi|452003611|gb|EMD96068.1| hypothetical protein COCHEDRAFT_1166905 [Bipolaris maydis C5] gi|477593859|gb|ENI10928.1| hypothetical protein COCC4DRAFT_46559 [Bipolaris maydis ATCC 48331] gi|576924864|gb|EUC38971.1| hypothetical protein COCCADRAFT_21712 [Bipolaris zeicola 26-R-13] gi|578485559|gb|EUN23053.1| hypothetical protein COCVIDRAFT_109868 [Bipolaris victoriae FI3] Length = 239 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQIL KRI Sbjct: 179 QRLVTPQRLQHKRHRLALKRRRAEASKDAANEYAQILSKRI 219 >gb|KIX02138.1| 40S ribosomal protein S6-B [Rhinocladiella mackenziei CBS 650.93] Length = 239 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQLLAKRV 219 >ref|XP_008021674.1| hypothetical protein SETTUDRAFT_102110 [Setosphaeria turcica Et28A] gi|482814318|gb|EOA90996.1| hypothetical protein SETTUDRAFT_102110 [Setosphaeria turcica Et28A] Length = 239 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEYAQIL KR+ Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYAQILSKRM 219 >ref|XP_007676134.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia compniacensis UAMH 10762] gi|449300641|gb|EMC96653.1| hypothetical protein BAUCODRAFT_34032 [Baudoinia compniacensis UAMH 10762] Length = 239 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+A+KRRRAEASKDAANEYAQIL KR+ Sbjct: 179 QRLVTPQRLQHKRHRIAIKRRRAEASKDAANEYAQILHKRV 219 >gb|KIW49324.1| 40S ribosomal protein S6-B [Exophiala xenobiotica] Length = 239 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 179 QRLVTPQRMQHKRHRIALKRRRAEASKDAANEYAQLLAKRV 219 >gb|KIW45626.1| 40S ribosomal protein S6-B, variant [Exophiala oligosperma] Length = 172 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 112 QRLVTPQRMQHKRHRIALKRRRAEASKDAANEYAQLLAKRV 152 >gb|KIW45625.1| 40S ribosomal protein S6-B [Exophiala oligosperma] Length = 239 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 179 QRLVTPQRMQHKRHRIALKRRRAEASKDAANEYAQLLAKRV 219 >gb|KIW16184.1| 40S ribosomal protein S6-B [Exophiala spinifera] Length = 239 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 179 QRLVTPQRMQHKRHRIALKRRRAEASKDAANEYAQLLAKRV 219 >ref|XP_007921818.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocercospora fijiensis CIRAD86] gi|452989257|gb|EME89012.1| hypothetical protein MYCFIDRAFT_181407 [Pseudocercospora fijiensis CIRAD86] Length = 241 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEA+KDAANEYAQIL KR+ Sbjct: 181 QRLVTPQRLQHKRHRIALKRRRAEAAKDAANEYAQILHKRV 221 >gb|KKY22176.1| putative 40s ribosomal protein s6 [Phaeomoniella chlamydospora] Length = 239 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAAN+YAQ+L KR+ Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANDYAQLLAKRV 219 >gb|KIV98223.1| 40S ribosomal protein S6-A, variant [Exophiala mesophila] Length = 197 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEY+Q+L KR+ Sbjct: 137 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYSQLLAKRV 177 >gb|KIV98222.1| 40S ribosomal protein S6-A [Exophiala mesophila] Length = 239 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQRLQHKRHR+ALKRRRAEASKDAANEY+Q+L KR+ Sbjct: 179 QRLVTPQRLQHKRHRIALKRRRAEASKDAANEYSQLLAKRV 219 >gb|KIV80959.1| 40S ribosomal protein S6-B, variant [Exophiala sideris] Length = 172 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 112 QRLVTPQRMQHKRHRLALKRRRAEASKDAANEYAQLLSKRV 152 >gb|KIV80958.1| 40S ribosomal protein S6-B [Exophiala sideris] Length = 239 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 266 QRLVTPQRLQHKRHRVALKRRRAEASKDAANEYAQILPKRI 144 QRLVTPQR+QHKRHR+ALKRRRAEASKDAANEYAQ+L KR+ Sbjct: 179 QRLVTPQRMQHKRHRLALKRRRAEASKDAANEYAQLLSKRV 219