BLASTX nr result
ID: Anemarrhena21_contig00064781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064781 (378 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 72 2e-12 ref|XP_010108229.1| 30S ribosomal protein S12-B [Morus notabilis... 70 7e-10 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 71.6 bits (174), Expect(2) = 2e-12 Identities = 36/55 (65%), Positives = 39/55 (70%) Frame = -1 Query: 174 PRFPRGGWAVFPRRPPSGGRKRTRVGSARFAFSC*ERTYHSLIEARVHAGKAQQS 10 PRFPRGG AVFP+RP SGGRKRTRVGSARFAFSC E S R G+ + S Sbjct: 433 PRFPRGGRAVFPQRPASGGRKRTRVGSARFAFSCVESFSFSYRSPRPRRGRVKSS 487 Score = 26.6 bits (57), Expect(2) = 2e-12 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 281 RMHCISIDEKEAGFTE*E 228 R HC+S EKE FTE E Sbjct: 405 RAHCVSTGEKEVDFTEEE 422 >ref|XP_010108229.1| 30S ribosomal protein S12-B [Morus notabilis] gi|587931382|gb|EXC18469.1| 30S ribosomal protein S12-B [Morus notabilis] Length = 158 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = -1 Query: 186 CLLD--PRFPRGGWAVFPRRPPSGGRKRTRVGSARFAFSC 73 CLLD PRFPRGG AV P+RP SGGRKRTRVGSARFAFSC Sbjct: 114 CLLDSHPRFPRGGRAVIPQRPASGGRKRTRVGSARFAFSC 153