BLASTX nr result
ID: Anemarrhena21_contig00064588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064588 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008027396.1| hypothetical protein SETTUDRAFT_117214 [Seto... 63 9e-08 ref|XP_003845617.1| predicted protein [Leptosphaeria maculans JN... 61 3e-07 ref|XP_001793823.1| hypothetical protein SNOG_03252 [Phaeosphaer... 59 2e-06 ref|XP_003305785.1| hypothetical protein PTT_18723 [Pyrenophora ... 57 4e-06 ref|XP_001932581.1| hypothetical protein PTRG_02248 [Pyrenophora... 57 4e-06 >ref|XP_008027396.1| hypothetical protein SETTUDRAFT_117214 [Setosphaeria turcica Et28A] gi|482807937|gb|EOA84870.1| hypothetical protein SETTUDRAFT_117214 [Setosphaeria turcica Et28A] Length = 225 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 135 MPSFVRNS-RSYSFPPCIDSVEFAPQSEADLPDIDEDPFAHFLTPV 1 MPS++R S R+YSFPP +DS + A LPDIDEDPFAHF+TP+ Sbjct: 1 MPSYLRTSPRAYSFPPWVDSADHDDAQSAHLPDIDEDPFAHFITPI 46 >ref|XP_003845617.1| predicted protein [Leptosphaeria maculans JN3] gi|312222198|emb|CBY02138.1| predicted protein [Leptosphaeria maculans JN3] Length = 347 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -2 Query: 135 MPSFVRNS-RSYSFPPCIDSVEFAPQSEADLPDIDEDPFAHFLTPV 1 MPS +RNS R+YSFPP ID E + LPDIDEDPFAHF++P+ Sbjct: 1 MPSHLRNSSRAYSFPPWIDMAEHEASQASGLPDIDEDPFAHFISPI 46 >ref|XP_001793823.1| hypothetical protein SNOG_03252 [Phaeosphaeria nodorum SN15] gi|160705519|gb|EAT89983.2| hypothetical protein SNOG_03252 [Phaeosphaeria nodorum SN15] Length = 192 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 135 MPSFVRNS-RSYSFPPCIDSVEFAPQSEADLPDIDEDPFAHFLTPV 1 MPS++RN RSYS+PP ++ +E E +LPDIDEDPFAHF+TP+ Sbjct: 1 MPSYLRNPYRSYSYPPTLEGIE--EDYENNLPDIDEDPFAHFITPI 44 >ref|XP_003305785.1| hypothetical protein PTT_18723 [Pyrenophora teres f. teres 0-1] gi|311317043|gb|EFQ86116.1| hypothetical protein PTT_18723 [Pyrenophora teres f. teres 0-1] Length = 225 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 135 MPSFVRNS-RSYSFPPCIDSVEFAPQSEADLPDIDEDPFAHFLTPV 1 MPS++RN R+YSFPP I++ E + LPDIDEDPFAHF+TP+ Sbjct: 1 MPSYLRNPHRAYSFPPWIEAAE---NEASQLPDIDEDPFAHFITPI 43 >ref|XP_001932581.1| hypothetical protein PTRG_02248 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974187|gb|EDU41686.1| hypothetical protein PTRG_02248 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 225 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 135 MPSFVRNS-RSYSFPPCIDSVEFAPQSEADLPDIDEDPFAHFLTPV 1 MPS++RN R+YSFPP I++ E + LPDIDEDPFAHF+TP+ Sbjct: 1 MPSYLRNPHRAYSFPPWIEAAE---NEASQLPDIDEDPFAHFITPI 43