BLASTX nr result
ID: Anemarrhena21_contig00064556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064556 (356 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008031673.1| hypothetical protein SETTUDRAFT_166504 [Seto... 61 3e-07 ref|XP_007686672.1| hypothetical protein COCMIDRAFT_91742 [Bipol... 58 2e-06 gb|EMD97737.1| hypothetical protein COCHEDRAFT_1151322 [Bipolari... 58 2e-06 ref|XP_007704105.1| hypothetical protein COCSADRAFT_40511 [Bipol... 58 2e-06 >ref|XP_008031673.1| hypothetical protein SETTUDRAFT_166504 [Setosphaeria turcica Et28A] gi|482804042|gb|EOA81167.1| hypothetical protein SETTUDRAFT_166504 [Setosphaeria turcica Et28A] Length = 309 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -1 Query: 113 MFAALASHGPPLTPHEALSGVFGSISLASWIFLLV 9 MFAA SH P LTP EALSGVFGSISLASWIFLLV Sbjct: 1 MFAAALSHAPSLTPQEALSGVFGSISLASWIFLLV 35 >ref|XP_007686672.1| hypothetical protein COCMIDRAFT_91742 [Bipolaris oryzae ATCC 44560] gi|576933337|gb|EUC46865.1| hypothetical protein COCMIDRAFT_91742 [Bipolaris oryzae ATCC 44560] Length = 310 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 113 MFAALASHGPPLTPHEALSGVFGSISLASWIFLLV 9 M AA SH LTPHEALSGVFGSISLASWIFLLV Sbjct: 1 MLAAALSHSLSLTPHEALSGVFGSISLASWIFLLV 35 >gb|EMD97737.1| hypothetical protein COCHEDRAFT_1151322 [Bipolaris maydis C5] Length = 310 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 113 MFAALASHGPPLTPHEALSGVFGSISLASWIFLLV 9 M AA SH LTPHEALSGVFGSISLASWIFLLV Sbjct: 1 MLAAAMSHSLSLTPHEALSGVFGSISLASWIFLLV 35 >ref|XP_007704105.1| hypothetical protein COCSADRAFT_40511 [Bipolaris sorokiniana ND90Pr] gi|451846774|gb|EMD60083.1| hypothetical protein COCSADRAFT_40511 [Bipolaris sorokiniana ND90Pr] Length = 310 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/35 (82%), Positives = 29/35 (82%) Frame = -1 Query: 113 MFAALASHGPPLTPHEALSGVFGSISLASWIFLLV 9 M AA SH LTPHEALSGVFGSISLASWIFLLV Sbjct: 1 MLAAAMSHSLSLTPHEALSGVFGSISLASWIFLLV 35